CBP/KAT3A Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238774-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP238774 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
CBP/KAT3A
Classification
Polyclonal
Dilution
Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
Q92793
Gene Symbols
CREBBP
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE
Quantity
0.1 mL
Research Discipline
Cancer, Cellular Markers, Chromatin Research, HIF Target Genes, Hypoxia, Membrane Trafficking and Chaperones, Signal Transduction, Stem Cell Signaling Pathway, Transcription Factors and Regulators
Gene ID (Entrez)
1387
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
CBPRTS, CREB binding protein, CREB-binding protein, EC 2.3.1.48, KAT3A, RSTS, Rubinstein-Taybi syndrome
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- CBP/KAT3A Polyclonal specifically detects CBP/KAT3A in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: CBP/KAT3A
Classification: Polyclonal
Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q92793
Gene Symbols: CREBBP
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE
Quantity: 0.1 mL
Research Discipline: Cancer, Cellular Markers, Chromatin Research, HIF Target Genes, Hypoxia, Membrane Trafficking and Chaperones, Signal Transduction, Stem Cell Signaling Pathway, Transcription Factors and Regulators
Gene ID (Entrez): 1387
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: CBPRTS, CREB binding protein, CREB-binding protein, EC 2.3.1.48, KAT3A, RSTS, Rubinstein-Taybi syndrome
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: VASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 1387
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: Troponin I type 2 (fast skeletal)
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Gene Accession No.: P48788
Gene Symbols: TNNI2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSK
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 7136
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: skeletal, fast, troponin I type 2 (skeletal, fast), troponin I, fast skeletal muscle, Troponin I, fast-twitch isoform, troponin I, fast-twitch skeletal muscle isoform
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.