SLC7A10 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238816-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP238816 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
SLC7A10
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
Q9NS82
Gene Symbols
SLC7A10
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IFQGHFEELRPSNAFAFWMTP
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
asc-1, ASC1, asc-type amino acid transporter 1, FLJ20839, HASC-1, solute carrier family 7 (neutral amino acid transporter light chain, asc system), member 10, solute carrier family 7 member 10, solute carrier family 7, (cationic amino acid transporter, y+ system) member 10, solute carrier family 7, (neutral amino acid transporter, y+ system) member 10
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
56301
Target Species
Human
Isotype
IgG
Related Products
Description
- SLC7A10 Polyclonal specifically detects SLC7A10 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SLC7A10
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q9NS82
Gene Symbols: SLC7A10
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IFQGHFEELRPSNAFAFWMTP
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: asc-1, ASC1, asc-type amino acid transporter 1, FLJ20839, HASC-1, solute carrier family 7 (neutral amino acid transporter light chain, asc system), member 10, solute carrier family 7 member 10, solute carrier family 7, (cationic amino acid transporter, y+ system) member 10, solute carrier family 7, (neutral amino acid transporter, y+ system) member 10
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 56301
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: IFQGHFEELRPSNAFAFWMTP
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 56301
Target Species: __
Isotype: __
Antigen: RASL10B
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: Q96S79
Gene Symbols: RASL10B
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVN
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: MGC47540, Ras-like protein VTS58635, RAS-like, family 10, member B, Ras-related protein 17, RRP17ras-like protein family member 10B, VTS58635
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 91608
Target Species: Human
Isotype: IgG