non-muscle heavy chain 10 Myosin Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238824-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP238824 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
non-muscle heavy chain 10 Myosin
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.
P35580
Gene Symbols
MYH10
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDA
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
Cellular myosin heavy chain, type B, cellular myosin heavy chain, type B type B, heavy polypeptide 10, non-muscle, MGC134913, MGC134914, Myosin heavy chain 10, Myosin heavy chain, non-muscle IIb, myosin heavy chain, nonmuscle type B, myosin, heavy chain 10, non-muscle, myosin-10, near to the ATP binding region, NMMHC II-b, NMMHCB, NMMHC-B, NMMHC-IIB, Non-muscle myosin heavy chain B, nonmuscle myosin heavy chain IIB, Non-muscle myosin heavy chain IIb, nonmuscle myosin heavy chain-B, nonmuscle myosin II heavy chain-B
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
4628
Target Species
Human
Isotype
IgG
Related Products
Description
- Description non-muscle heavy chain 10 Myosin Polyclonal specifically detects non-muscle heavy chain 10 Myosin in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: non-muscle heavy chain 10 Myosin
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: P35580
Gene Symbols: MYH10
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDA
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Cellular myosin heavy chain, type B, cellular myosin heavy chain, type B type B, heavy polypeptide 10, non-muscle, MGC134913, MGC134914, Myosin heavy chain 10, Myosin heavy chain, non-muscle IIb, myosin heavy chain, nonmuscle type B, myosin, heavy chain 10, non-muscle, myosin-10, near to the ATP binding region, NMMHC II-b, NMMHCB, NMMHC-B, NMMHC-IIB, Non-muscle myosin heavy chain B, nonmuscle myosin heavy chain IIB, Non-muscle myosin heavy chain IIb, nonmuscle myosin heavy chain-B, nonmuscle myosin II heavy chain-B
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 4628
Target Species: Human
Isotype: IgG
Antigen: FAM189A2
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q15884
Gene Symbols: FAM189A2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MSEGSEAAVIPLDLGCTQVTQDGDIPNIPAEENASTSTPSSTLVRPIRSRRALPPLRTRSKSDPVLHPSEER
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: C9orf61, chromosome 9 open reading frame 61, family with sequence similarity 189, member A2, Friedreich ataxia region gene X123, MGC142243, MGC142245, Protein X123, X123RP11-548B3.1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 9413
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: MSEGSEAAVIPLDLGCTQVTQDGDIPNIPAEENASTSTPSSTLVRPIRSRRALPPLRTRSKSDPVLHPSEER
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 9413
Target Species: __
Isotype: __