RUNX3/CBFA3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238863-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP238863 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
RUNX3/CBFA3
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.
Q13761
Gene Symbols
RUNX3
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNP
Quantity
0.1 mL
Research Discipline
Transcription Factors and Regulators
Gene ID (Entrez)
864
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
Acute myeloid leukemia 2 protein, AML2SL3/AKV core-binding factor alpha C subunit, CBFA3MGC16070, CBF-alpha-3, PEA2 alpha C, PEA2-alpha C, PEBP2 alpha C, PEBP2A3FLJ34510, PEBP2-alpha C, runt domain, alpha subunit 3, runt-related transcription factor 3, SL3-3 enhancer factor 1 alpha C subunit, transcription factor AML2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- RUNX3/CBFA3 Polyclonal specifically detects RUNX3/CBFA3 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: RUNX3/CBFA3
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q13761
Gene Symbols: RUNX3
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNP
Quantity: 0.1 mL
Research Discipline: Transcription Factors and Regulators
Gene ID (Entrez): 864
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Acute myeloid leukemia 2 protein, AML2SL3/AKV core-binding factor alpha C subunit, CBFA3MGC16070, CBF-alpha-3, PEA2 alpha C, PEA2-alpha C, PEBP2 alpha C, PEBP2A3FLJ34510, PEBP2-alpha C, runt domain, alpha subunit 3, runt-related transcription factor 3, SL3-3 enhancer factor 1 alpha C subunit, transcription factor AML2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: DQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNP
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 864
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: PRP19
Classification: Polyclonal
Dilution: Western Blot 1:100 - 1:250, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q9UMS4
Gene Symbols: PRPF19
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSV
Quantity: 0.1 mL
Research Discipline: Apoptosis, Cancer, DNA Repair, GPCR, Tumor Suppressors
Gene ID (Entrez): 27339
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: hPSO4, NMP200SNEV, Nuclear matrix protein 200, nuclear matrix protein NMP200 related to splicing factor PRP19, pre-mRNA-processing factor 19, PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae), PRP19PRP19/PSO4 homolog (S. cerevisiae), PSO4PRP19/PSO4 homolog, Senescence evasion factor, UBOX4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.