SF2 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238912-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP238912 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SF2
Classification
Polyclonal
Dilution
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Gene Accession No.
Q07955
Gene Symbols
SRSF1
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DYDGYRLRVEFPRSGRGTGRG
Quantity
0.1 mL
Research Discipline
DNA replication Transcription Translation and Splicing
Gene ID (Entrez)
6426
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
Alternative-splicing factor 1, ASFpre-mRNA-splicing factor SF2, P33 subunit, MGC5228, serine/arginine-rich splicing factor 1, SF2FLJ53078, SF2p33, SFRS1splicing factor 2, Splicing factor, arginine/serine-rich 1ASF-1, SR splicing factor 1, SRp30a
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description SF2 Polyclonal specifically detects SF2 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SF2
Classification: Polyclonal
Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Gene Accession No.: Q07955
Gene Symbols: SRSF1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DYDGYRLRVEFPRSGRGTGRG
Quantity: 0.1 mL
Research Discipline: DNA replication Transcription Translation and Splicing
Gene ID (Entrez): 6426
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Alternative-splicing factor 1, ASFpre-mRNA-splicing factor SF2, P33 subunit, MGC5228, serine/arginine-rich splicing factor 1, SF2FLJ53078, SF2p33, SFRS1splicing factor 2, Splicing factor, arginine/serine-rich 1ASF-1, SR splicing factor 1, SRp30a
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: DYDGYRLRVEFPRSGRGTGRG
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 6426
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: Dystrobrevin beta
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: O60941
Gene Symbols: DTNB
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQ
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 1838
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: beta-dystrobrevin, DTN-B, dystrobrevin beta, dystrobrevin, beta, MGC17163, MGC57126
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.