V-type proton ATPase subunit F Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238942-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP238942 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
V-type proton ATPase subunit F
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.
Q16864
Gene Symbols
ATP6V1F
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDL
Quantity
0.1 mL
Research Discipline
metabolism
Gene ID (Entrez)
9296
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
ATP6S14adenosinetriphosphatase 14k chain, ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F, H(+)-transporting two-sector ATPase, 14kD subunit, MGC117321, MGC126037, MGC126038, vacuolar ATP synthase subunit F, vacuolar proton pump F subunit, Vacuolar proton pump subunit F, VATFATPase, vacuolar, 14 kD, V-ATPase 14 kDa subunit, V-ATPase F subunit, V-ATPase subunit F, Vma7, V-type proton ATPase subunit F
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- V-type proton ATPase subunit F Polyclonal specifically detects V-type proton ATPase subunit F in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: V-type proton ATPase subunit F
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q16864
Gene Symbols: ATP6V1F
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDL
Quantity: 0.1 mL
Research Discipline: metabolism
Gene ID (Entrez): 9296
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: ATP6S14adenosinetriphosphatase 14k chain, ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F, H(+)-transporting two-sector ATPase, 14kD subunit, MGC117321, MGC126037, MGC126038, vacuolar ATP synthase subunit F, vacuolar proton pump F subunit, Vacuolar proton pump subunit F, VATFATPase, vacuolar, 14 kD, V-ATPase 14 kDa subunit, V-ATPase F subunit, V-ATPase subunit F, Vma7, V-type proton ATPase subunit F
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: RESLNASIVDAINQAADCWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEG
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 30968
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: ENPP-1
Classification: Polyclonal
Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: P22413
Gene Symbols: ENPP1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC
Quantity: 0.1 mL
Research Discipline: Lipid and Metabolism
Gene ID (Entrez): 5167
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: ectonucleotide pyrophosphatase/phosphodiesterase 1, E-NPP 1, Ly-41 antigen, M6S1NPP1, Membrane component chromosome 6 surface marker 1, membrane component, chromosome 6, surface marker 1, NPPSalkaline phosphodiesterase 1, PC1, PC-1, PCA1ARHR2, PDNP1ectonucleotide pyrophosphatase/phosphodiesterase family member 1, Phosphodiesterase I/nucleotide pyrophosphatase 1, plasma-cell membrane glycoprotein 1, Plasma-cell membrane glycoprotein PC-1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.