Orai2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP239064-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP239064 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Orai2
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
Q96SN7
Gene Symbols
ORAI2
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IKFLPVDARRQPGPPPGPGSHTGW
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
CAP-binding protein complex interacting protein 2, CAP-binding protein complex-interacting protein 2, CBCIP2C7orf19FLJ12474, chromosome 7 open reading frame 19, FLJ14733, H_NH0514P08.8, MEM142B, ORAI calcium release-activated calcium modulator 2, protein orai-2, putative protein ORAI2-2, TMEM142B, Transmembrane protein 142BFLJ44818
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
80228
Target Species
Human
Isotype
IgG
Related Products
Description
- Description Orai2 Polyclonal specifically detects Orai2 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Orai2
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q96SN7
Gene Symbols: ORAI2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IKFLPVDARRQPGPPPGPGSHTGW
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: CAP-binding protein complex interacting protein 2, CAP-binding protein complex-interacting protein 2, CBCIP2C7orf19FLJ12474, chromosome 7 open reading frame 19, FLJ14733, H_NH0514P08.8, MEM142B, ORAI calcium release-activated calcium modulator 2, protein orai-2, putative protein ORAI2-2, TMEM142B, Transmembrane protein 142BFLJ44818
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 80228
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: IKFLPVDARRQPGPPPGPGSHTGW
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 80228
Target Species: __
Isotype: __
Antigen: ZNF548
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: Q8NEK5
Gene Symbols: ZNF548
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HRVHMAEEIFTCMEGWKDLPATSCLLQHQGPQSEWKPYRDTEDREAFQTGQ
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: FLJ32932, zinc finger protein 548
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 147694
Target Species: Human
Isotype: IgG