HIV-1 Gag p24 Antibody (7F4), Biotin, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP241340-Each-of-1 | In Stock | ₹ 53,218.32 |
NBP241340 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,218.32
GST (18%): ₹ 9,579.298
Total Price: ₹ 62,797.618
Antigen
HIV-1 Gag p24
Classification
Monoclonal
Concentration
1 mg/mL
Dilution
Western Blot 0.2-0.5 μg/mL, ELISA 0.2-0.5 μg/mL
Gene Alias
Capsid protein p24, Human immunodeficiency virus 1, Human immunodeficiency virus type 1 p24
Host Species
Mouse
Molecular Weight of Antigen
24, 41, 55 kDa
Quantity
0.1 mg
Primary or Secondary
Primary
Test Specificity
By Western blot, anti-HIV-1 Gag p24 antibody detects a ∼24 kDa, a ∼41 kDa, and a ∼55 kDa protein, corresponding to HIV-1 Gag p24 and to its precursors p41 and p55, respectively, in HIV-1 samples.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, ELISA
Clone
7F4
Conjugate
Biotin
Formulation
Antibody is supplied in PBS containing 1% BSA and 0.02% sodium azide. with 0.02% Sodium Azide
Gene Symbols
gag
Immunogen
Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
155030
Target Species
Virus
Isotype
IgG1
Related Products
Description
- HIV-1 Gag p24 Monoclonal antibody specifically detects HIV-1 Gag p24 in Virus samples
- It is validated for Western Blot, ELISA.
Compare Similar Items
Show Difference
Antigen: HIV-1 Gag p24
Classification: Monoclonal
Concentration: 1 mg/mL
Dilution: Western Blot 0.2-0.5 μg/mL, ELISA 0.2-0.5 μg/mL
Gene Alias: Capsid protein p24, Human immunodeficiency virus 1, Human immunodeficiency virus type 1 p24
Host Species: Mouse
Molecular Weight of Antigen: 24, 41, 55 kDa
Quantity: 0.1 mg
Primary or Secondary: Primary
Test Specificity: By Western blot, anti-HIV-1 Gag p24 antibody detects a ∼24 kDa, a ∼41 kDa, and a ∼55 kDa protein, corresponding to HIV-1 Gag p24 and to its precursors p41 and p55, respectively, in HIV-1 samples.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, ELISA
Clone: 7F4
Conjugate: Biotin
Formulation: Antibody is supplied in PBS containing 1% BSA and 0.02% sodium azide. with 0.02% Sodium Azide
Gene Symbols: gag
Immunogen: Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein. Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 155030
Target Species: Virus
Isotype: IgG1
Antigen: Swine Influenza A H1N1 NS1
Classification: Polyclonal
Concentration: 1 mg/mL
Dilution: ELISA
Gene Alias: __
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 0.1 mg
Primary or Secondary: Primary
Test Specificity: This antibody is specific for the Swine-Origin H1N1 influenza NS1 and will not recognize the corresponding NS1 sequence from the seasonal H1N1 influenza (A/South Australia/51/2005 (H1N1)).
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: ELISA
Clone: __
Conjugate: Unconjugated
Formulation: PBS with 0.02% Sodium Azide
Gene Symbols: __
Immunogen: Antibody was raised against a synthetic peptide from the swine-Origin Influenza NS1. The immunogen is located within the last 50 amino acids of Swine H1N1 Nonstructural Protein 1. Amino Acid Squence: DENGRPSLPPE
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 2828679
Target Species: Virus
Isotype: IgG
Antigen: SFXN4
Classification: Polyclonal
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Alias: BCRM1, Breast cancer resistance marker 1, sideroflexin 4, sideroflexin-4
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: __
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Clone: __
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: SFXN4
Immunogen: Synthetic peptides corresponding to SFXN4 (sideroflexin 4) The peptide sequence was selected from the N terminal of SFXN4. Peptide sequence: MSLEQEEETQPGRLLGRRDAVPAFIEPNVRFWITERQSFIRRFLQWTELL.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 119559
Target Species: Human
Isotype: IgG
