PRKCDBP Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP247323-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP247323 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PRKCDBP
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
Cavin-3, hSRBC, MGC20400, protein kinase C, delta binding protein, sdr-related gene product that binds to c-kinase, Serum deprivation response factor-related gene product that binds to C-kinase, SRBCprotein kinase C delta-binding protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
PRKCDBP
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VHAVTVVTLLEKLASMLETLRERQGGLARRQGGLAGSVRRIQSGLGALSRSHDTTSNTLAQLLAKAERVSSHANAAQE
Quantity
0.1 mL
Research Discipline
Diabetes Research, Lipid and Metabolism
Gene ID (Entrez)
112464
Target Species
Human
Isotype
IgG
Related Products
Description
- PRKCDBP Polyclonal specifically detects PRKCDBP in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: PRKCDBP
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: Cavin-3, hSRBC, MGC20400, protein kinase C, delta binding protein, sdr-related gene product that binds to c-kinase, Serum deprivation response factor-related gene product that binds to C-kinase, SRBCprotein kinase C delta-binding protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: PRKCDBP
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VHAVTVVTLLEKLASMLETLRERQGGLARRQGGLAGSVRRIQSGLGALSRSHDTTSNTLAQLLAKAERVSSHANAAQE
Quantity: 0.1 mL
Research Discipline: Diabetes Research, Lipid and Metabolism
Gene ID (Entrez): 112464
Target Species: Human
Isotype: IgG
Antigen: PPPDE2
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: D15Wsu75e, DJ347H13.4, FAM152B, family with sequence similarity 152, member B, MGC138384, PPPDE peptidase domain containing 2, PPPDE peptidase domain-containing protein 2, Protein FAM152B
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: DESI1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEE
Quantity: 0.1 mL
Research Discipline: Proteases & Other Enzymes
Gene ID (Entrez): 27351
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: VAINRLLSMGQLDLLRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPLTEINK
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 10621
Target Species: __
Isotype: __