Elp4 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP247473-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP247473 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Elp4
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
C11orf19, chromosome 11 open reading frame 19, dJ68P15A.1, elongation protein 4 homolog (S. cerevisiae), elongator complex protein 4, hELP4, PAX6 neighbor gene protein, PAX6NEB, PAXNEBFLJ20498
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
ELP4
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIRQIPRLNNLICDESDVKD
Quantity
0.1 mL
Research Discipline
DNA replication Transcription Translation and Splicing
Gene ID (Entrez)
26610
Target Species
Human
Isotype
IgG
Related Products
Description
- Elp4 Polyclonal specifically detects Elp4 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Elp4
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: C11orf19, chromosome 11 open reading frame 19, dJ68P15A.1, elongation protein 4 homolog (S. cerevisiae), elongator complex protein 4, hELP4, PAX6 neighbor gene protein, PAX6NEB, PAXNEBFLJ20498
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: ELP4
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIRQIPRLNNLICDESDVKD
Quantity: 0.1 mL
Research Discipline: DNA replication Transcription Translation and Splicing
Gene ID (Entrez): 26610
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: DEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEI
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 23741
Target Species: __
Isotype: __
Antigen: EI2BL
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: EC 5.3.1.23, M1Pi, Mediator of RhoA-dependent invasion, methylthioribose-1-phosphate isomerase, methylthioribose-1-phosphate isomerase homolog (S. cerevisiae), MGC3207, MRDI, MTNA, MTR-1-P isomerase, S-methyl-5-thioribose-1-phosphate isomerase, Translation initiation factor eIF-2B subunit alpha/beta/delta-like protein, Ypr118w
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: MRI1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HGIPFYVAAPSSSCDLRLETGKEIIIEERPGQELTDVNGVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELRTALTTTISSRD
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 84245
Target Species: Human
Isotype: IgG