POTEE Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP254706-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP254706 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
POTEE
Classification
Polyclonal
Dilution
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
A26C1, A26C1A, ANKRD26-Like Family C Member 1A, ANKRD26-Like Family C, Member 1A, Cancer/Testis Antigen Family 104, Member 2, CT104.2, POTE Ankyrin Domain Family Member E, POTE2, POTE-2, POTE2gamma, Prostate, Ovary, Testis-Expressed Protein On Chromosome 2, Protein Expressed In Prostate, Ovary, Testis, And Placenta 2
Host Species
Rabbit
Purification Method
Immunogen affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
445582
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
POTEe
Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids:LKALQLNELTMDDDTAVLVIDNGS
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- POTEE Polyclonal specifically detects POTEE in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: POTEE
Classification: Polyclonal
Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: A26C1, A26C1A, ANKRD26-Like Family C Member 1A, ANKRD26-Like Family C, Member 1A, Cancer/Testis Antigen Family 104, Member 2, CT104.2, POTE Ankyrin Domain Family Member E, POTE2, POTE-2, POTE2gamma, Prostate, Ovary, Testis-Expressed Protein On Chromosome 2, Protein Expressed In Prostate, Ovary, Testis, And Placenta 2
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 445582
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: POTEe
Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:LKALQLNELTMDDDTAVLVIDNGS
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: A26C1, A26C1A, ANKRD26-Like Family C Member 1A
Host Species: __
Purification Method: __
Regulatory Status: RUO
Gene ID (Entrez): __
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: SREBP1
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: BHLHD1, Class D basic helix-loop-helix protein 1, SREBP 1c, SREBP-1, SREBP1bHLHd1SREBP-1c, sterol regulatory element binding protein-1, sterol regulatory element binding transcription factor 1, sterol regulatory element-binding protein 1, Sterol regulatory element-binding transcription factor 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 6720
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SREBF1
Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:SLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAI
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.