ACOT1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP254709-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP254709 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
ACOT1
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1 - 4ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias
ACH2, acyl-CoA thioesterase 1Long chain acyl-CoA thioester hydrolase, acyl-coenzyme A thioesterase 1, CTE1, CTE-1, CTE-I, CTE-Ib, EC 3.1.2.2, Inducible cytosolic acyl-coenzyme A thioester hydrolase, LACH2, Long chain acyl-CoA hydrolase
Host Species
Rabbit
Purification Method
Immunogen affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
641371
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ACOT1
Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids:YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ACOT1 Polyclonal specifically detects ACOT1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ACOT1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1 - 4ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: ACH2, acyl-CoA thioesterase 1Long chain acyl-CoA thioester hydrolase, acyl-coenzyme A thioesterase 1, CTE1, CTE-1, CTE-I, CTE-Ib, EC 3.1.2.2, Inducible cytosolic acyl-coenzyme A thioester hydrolase, LACH2, Long chain acyl-CoA hydrolase
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 641371
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ACOT1
Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: CTE1, CTE-1, CTE-I
Host Species: __
Purification Method: __
Regulatory Status: RUO
Gene ID (Entrez): __
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: Placental Lactogen/CSH1
Classification: Polyclonal
Dilution: Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: Choriomammotropin, chorionic somatomammotropin hormone, chorionic somatomammotropin hormone 1 (placental lactogen), CS-1, CSAchorionic somatomammotropin A, CSH2, CSMT, FLJ75407, hCS-A, Lactogen, Placental lactogen, PLchoriomammotropin
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 1442
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CSH1
Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
