Carm1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP254924-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP254924 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Carm1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
coactivator-associated arginine methyltransferase 1EC 2.1.1.-, EC 2.1.1, histone-arginine methyltransferase CARM1, PRMT4EC 2.1.1.125, Protein arginine N-methyltransferase 4
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
CARM1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSFYNILKTCRGHTLERSVFSERTEESSAVQYFQFYGYLSQQQ
Quantity
100 μL
Research Discipline
Cancer, Cellular Markers, Transcription Factors and Regulators, Tumor Suppressors
Gene ID (Entrez)
10498
Target Species
Human
Isotype
IgG
Related Products
Description
- Carm1 Polyclonal specifically detects Carm1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Carm1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: coactivator-associated arginine methyltransferase 1EC 2.1.1.-, EC 2.1.1, histone-arginine methyltransferase CARM1, PRMT4EC 2.1.1.125, Protein arginine N-methyltransferase 4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CARM1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSFYNILKTCRGHTLERSVFSERTEESSAVQYFQFYGYLSQQQ
Quantity: 100 μL
Research Discipline: Cancer, Cellular Markers, Transcription Factors and Regulators, Tumor Suppressors
Gene ID (Entrez): 10498
Target Species: Human
Isotype: IgG
Antigen: EVI5L
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: ecotropic viral integration site 5-like, Ecotropic viral integration site 5-like protein, EVI5-like protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: EVI5L
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEA
Quantity: 100 μL
Research Discipline: Signal Transduction
Gene ID (Entrez): 115704
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: KIAA1852FLJ14260, Zinc finger protein 328, zinc finger protein 606, ZNF328
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 80095
Target Species: __
Isotype: __