TSC22/TSC22D1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP254941-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP254941 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
TSC22/TSC22D1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Cerebral protein 2, KIAA1994, MGC17597, Regulatory protein TSC-22, RP11-269C23.2, TGFB1I4, TGFB-stimulated clone 22 homolog, transforming growth factor beta 1 induced transcript 4, Transforming growth factor beta-1-induced transcript 4 protein, transforming growth factor beta-stimulated protein TSC-22, TSC22 domain family 1, TSC22 domain family protein 1, TSC22 domain family, member 1, TSC22DKFZp686O19206
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
TSC22D1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QYGQQQPMVSTQMAPGHVKSVTQNPASEYVQQQPILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTAVPAQPAGASVQP
Quantity
100 μL
Research Discipline
Cancer
Gene ID (Entrez)
8848
Target Species
Human
Isotype
IgG
Related Products
Description
- TSC22/TSC22D1 Polyclonal specifically detects TSC22/TSC22D1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: TSC22/TSC22D1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Cerebral protein 2, KIAA1994, MGC17597, Regulatory protein TSC-22, RP11-269C23.2, TGFB1I4, TGFB-stimulated clone 22 homolog, transforming growth factor beta 1 induced transcript 4, Transforming growth factor beta-1-induced transcript 4 protein, transforming growth factor beta-stimulated protein TSC-22, TSC22 domain family 1, TSC22 domain family protein 1, TSC22 domain family, member 1, TSC22DKFZp686O19206
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TSC22D1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QYGQQQPMVSTQMAPGHVKSVTQNPASEYVQQQPILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTAVPAQPAGASVQP
Quantity: 100 μL
Research Discipline: Cancer
Gene ID (Entrez): 8848
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: Cerebral protein 2, KIAA1994, MGC17597, Regulatory protein TSC-22, RP11-269C23.2, TGFB1I4, TGFB-stimulated clone 22 homolog, transforming growth factor beta 1 induced transcript 4, Transforming growth factor beta-1-induced transcript 4 protein, transformi
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 8848
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: KIAA0610SPARTIN, spastic paraplegia 20 (Troyer syndrome), Spastic paraplegia 20 protein, TAHCCP1spartin, Trans-activated by hepatitis C virus core protein 1
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 23111
Target Species: __
Isotype: __
