ISG15 Activating Enzyme/UBE1L Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255032-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255032 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
ISG15 Activating Enzyme/UBE1L
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
D8UBA1, ubiquitin-activating enzyme E1 homolog B, UBA1B, UBA7, ubiquitin-activating enzyme E1, UBE1L, UBE2MGC12713, Ubiquitin-activating enzyme 7, Ubiquitin-activating enzyme E1 homolog, ubiquitin-activating enzyme E1-like, ubiquitin-activating enzyme E1-related protein, ubiquitin-activating enzyme-2, ubiquitin-like modifier activating enzyme 7, ubiquitin-like modifier-activating enzyme 7
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
7318
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
UBA7
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETVVGLARDLEPLKR
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ISG15 Activating Enzyme/UBE1L Polyclonal specifically detects ISG15 Activating Enzyme/UBE1L in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ISG15 Activating Enzyme/UBE1L
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: D8UBA1, ubiquitin-activating enzyme E1 homolog B, UBA1B, UBA7, ubiquitin-activating enzyme E1, UBE1L, UBE2MGC12713, Ubiquitin-activating enzyme 7, Ubiquitin-activating enzyme E1 homolog, ubiquitin-activating enzyme E1-like, ubiquitin-activating enzyme E1-related protein, ubiquitin-activating enzyme-2, ubiquitin-like modifier activating enzyme 7, ubiquitin-like modifier-activating enzyme 7
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 7318
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: UBA7
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETVVGLARDLEPLKR
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: MGA
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: FLJ12634, KIAA0518, MAD5, MAX dimerization protein 5, MAX gene associated, MAX gene-associated protein, MXD5
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 23269
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: MGA
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGVQLPLAPATSFPFWNLTGTNPASPDAGFPFVSRTGKTNDFTKIKGWRGKFHSASASRNEGGNSESSLKNRSAFCSD
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: FLJ12634, KIAA0518, MAD5, MAX dimerization protein 5, MAX gene associated, MAX gene-associated protein, MXD5
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 23269
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
