LZTR2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255068-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255068 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
LZTR2
Classification
Polyclonal
Dilution
Western Blot 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
DKFZp686C2486, FLJ23871, FLJ25761, KIAA1928, Leucine zipper transcription regulator 2FLJ36620, LZTR2SEC16Sprotein SEC16 homolog B, PGPR-p117, protein transport protein Sec16B, Regucalcin gene promoter region-related protein p117, regucalcin gene promotor region related protein, RGPRFLJ33652, RGPR-p117, SEC16 homolog B, SEC16 homolog B (S. cerevisiae)
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
89866
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
SEC16B
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SYQSPTMREEYAYGSYYYHGHPQWLQEERVPRQRSPYIWHEDYREQKYLDEHHYENQHSPFGTNSETHFQSNSR
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- LZTR2 Polyclonal specifically detects LZTR2 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: LZTR2
Classification: Polyclonal
Dilution: Western Blot 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DKFZp686C2486, FLJ23871, FLJ25761, KIAA1928, Leucine zipper transcription regulator 2FLJ36620, LZTR2SEC16Sprotein SEC16 homolog B, PGPR-p117, protein transport protein Sec16B, Regucalcin gene promoter region-related protein p117, regucalcin gene promotor region related protein, RGPRFLJ33652, RGPR-p117, SEC16 homolog B, SEC16 homolog B (S. cerevisiae)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 89866
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SEC16B
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SYQSPTMREEYAYGSYYYHGHPQWLQEERVPRQRSPYIWHEDYREQKYLDEHHYENQHSPFGTNSETHFQSNSR
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: DKFZp686C2486, FLJ23871, FLJ25761, KIAA1928, Leucine zipper transcription regulator 2FLJ36620, LZTR2SEC16Sprotein SEC16 homolog B, PGPR-p117, protein transport protein Sec16B, Regucalcin gene promoter region-related protein p117, regucalcin gene promotor
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 89866
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Antigen: HP1BP3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: heterochromatin protein 1, binding protein 3, heterochromatin protein 1-binding protein 3, HP1-BP74, MGC43701, Protein HP1-BP74
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 50809
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: HP1BP3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWME
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.