DMAP1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255093-Each-of-1 | In Stock | ₹ 55,847.50 |
NBP255093 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,847.50
GST (18%): ₹ 10,052.55
Total Price: ₹ 65,900.05
Antigen
DMAP1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
DNA methyltransferase 1 associated protein 1, DNA methyltransferase 1-associated protein 1, DNMAP1DNMT1-associated protein 1, DNMT1 associated protein 1, DNMTAP1, EAF2, FLJ11543, KIAA1425DKFZp686L09142, MEAF2, SWC4
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
DMAP1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AEEEYLLQELRKIEARKKEREKRSQDLQKLITAADTTAEQRRTERKAPKKKLPQKKEAEKPAVPETAGIKFPDFKSAGVTLRSQRMKLPSSVGQKKI
Quantity
100 μL
Research Discipline
Apoptosis, Chromatin Research, DNA Repair, MAP Kinase Signaling
Gene ID (Entrez)
55929
Target Species
Human
Isotype
IgG
Related Products
Description
- DMAP1 Polyclonal specifically detects DMAP1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: DMAP1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DNA methyltransferase 1 associated protein 1, DNA methyltransferase 1-associated protein 1, DNMAP1DNMT1-associated protein 1, DNMT1 associated protein 1, DNMTAP1, EAF2, FLJ11543, KIAA1425DKFZp686L09142, MEAF2, SWC4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: DMAP1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AEEEYLLQELRKIEARKKEREKRSQDLQKLITAADTTAEQRRTERKAPKKKLPQKKEAEKPAVPETAGIKFPDFKSAGVTLRSQRMKLPSSVGQKKI
Quantity: 100 μL
Research Discipline: Apoptosis, Chromatin Research, DNA Repair, MAP Kinase Signaling
Gene ID (Entrez): 55929
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: DNA methyltransferase 1 associated protein 1, DNA methyltransferase 1-associated protein 1, DNMAP1DNMT1-associated protein 1, DNMT1 associated protein 1, DNMTAP1, EAF2, FLJ11543, KIAA1425DKFZp686L09142, MEAF2, SWC4
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: −20°C, avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 55929
Target Species: __
Isotype: __
Antigen: ZNF326
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: zinc finger protein 394, zinc finger protein 99, Zinc finger protein with KRAB and SCAN domains 14, ZKSCAN14FLJ12298
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ZNF326
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FNEPEQSRFGGSYGGRFESSYRNSLDSFGGRNQGGSSWEAPYSRSKLRPGFMEDRGRENYSSYSS
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 284695
Target Species: Human
Isotype: IgG