CDK5 Activator 1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255112-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255112 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
CDK5 Activator 1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CDK5 activator 1, CDK5P35, CDK5R, cyclin-dependent kinase 5 activator 1, Cyclin-dependent kinase 5 regulatory subunit 1, cyclin-dependent kinase 5, regulatory subunit 1 (p35), MGC33831, NCK5A, neuronal CDK5 activator, p23, p25, p35, p35nck5a, regulatory partner for CDK5 kinase, tau protein kinase II 23kDa subunit, TPKII regulatory subunit
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
CDK5R1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDK
Quantity
100 μL
Research Discipline
Cell Cycle and Replication, Signal Transduction
Gene ID (Entrez)
8851
Target Species
Human
Isotype
IgG
Related Products
Description
- CDK5 Activator 1 Polyclonal specifically detects CDK5 Activator 1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: CDK5 Activator 1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CDK5 activator 1, CDK5P35, CDK5R, cyclin-dependent kinase 5 activator 1, Cyclin-dependent kinase 5 regulatory subunit 1, cyclin-dependent kinase 5, regulatory subunit 1 (p35), MGC33831, NCK5A, neuronal CDK5 activator, p23, p25, p35, p35nck5a, regulatory partner for CDK5 kinase, tau protein kinase II 23kDa subunit, TPKII regulatory subunit
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CDK5R1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDK
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication, Signal Transduction
Gene ID (Entrez): 8851
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: CDK5 activator 1, CDK5P35, CDK5R, cyclin-dependent kinase 5 activator 1, Cyclin-dependent kinase 5 regulatory subunit 1, cyclin-dependent kinase 5, regulatory subunit 1 (p35), MGC33831, NCK5A, neuronal CDK5 activator, p23, p25, p35, p35nck5a, regulatory p
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: −20°C, avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 8851
Target Species: __
Isotype: __
Antigen: BACH1
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: basic region leucine zipper transcriptional regulator BACH1, BTB and CNC homolog 1, BTB and CNC homology 1, basic leucine zipper transcription factor 1, HA2303, transcription regulator protein BACH1, transcription regulator protein10BACH-1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: BACH1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIIS
Quantity: 100 μL
Research Discipline: Breast Cancer, Cancer, DNA Repair
Gene ID (Entrez): 571
Target Species: Human
Isotype: IgG