AlphaA Crystallin/CRYAA Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255161-Each-of-1 | In Stock | ₹ 55,847.50 |
NBP255161 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,847.50
GST (18%): ₹ 10,052.55
Total Price: ₹ 65,900.05
Antigen
AlphaA Crystallin/CRYAA
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CRYA1crystallin, alpha-1, crystallin, alpha A, Heat shock protein beta-4, HSPB4alpha-crystallin A chain, human alphaA-crystallin (CRYA1), 10HspB4
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
CRYAA
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSA
Quantity
100 μL
Research Discipline
Membrane Trafficking and Chaperones, Vision
Gene ID (Entrez)
1409
Target Species
Human
Isotype
IgG
Related Products
Description
- AlphaA Crystallin/CRYAA Polyclonal specifically detects AlphaA Crystallin/CRYAA in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: AlphaA Crystallin/CRYAA
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CRYA1crystallin, alpha-1, crystallin, alpha A, Heat shock protein beta-4, HSPB4alpha-crystallin A chain, human alphaA-crystallin (CRYA1), 10HspB4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CRYAA
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSA
Quantity: 100 μL
Research Discipline: Membrane Trafficking and Chaperones, Vision
Gene ID (Entrez): 1409
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: CRYA1crystallin, alpha-1, crystallin, alpha A, Heat shock protein beta-4, HSPB4alpha-crystallin A chain, human alphaA-crystallin (CRYA1), 10HspB4
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: −20°C, avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 1409
Target Species: __
Isotype: __
Antigen: IL-15
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: IL-15MGC9721, interleukin 15, interleukin-15
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: IL15
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication, Cytokine Research, Immune System Diseases, Immunology, Innate Immunity
Gene ID (Entrez): 3600
Target Species: Human
Isotype: IgG