Cyclin B1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255200-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP255200 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
Cyclin B1
Classification
Polyclonal
Dilution
Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CCNB, cyclin B1, G2/mitotic-specific cyclin B1, G2/mitotic-specific cyclin-B1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
CCNB1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGAD
Quantity
100 μL
Research Discipline
Cancer, Cell Biology, Cell Cycle and Replication, Mitotic Regulators, Tumor Suppressors
Gene ID (Entrez)
891
Target Species
Human
Isotype
IgG
Related Products
Description
- Cyclin B1 Polyclonal specifically detects Cyclin B1 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.
Compare Similar Items
Show Difference
Antigen: Cyclin B1
Classification: Polyclonal
Dilution: Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CCNB, cyclin B1, G2/mitotic-specific cyclin B1, G2/mitotic-specific cyclin-B1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CCNB1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGAD
Quantity: 100 μL
Research Discipline: Cancer, Cell Biology, Cell Cycle and Replication, Mitotic Regulators, Tumor Suppressors
Gene ID (Entrez): 891
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: CCNB, cyclin B1, G2/mitotic-specific cyclin B1, G2/mitotic-specific cyclin-B1
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: −20°C, avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 891
Target Species: __
Isotype: __
Antigen: HOXD1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: homeo box 4G, homeo box D1, homeobox D1, homeobox protein Hox-D1, Homeobox protein Hox-GG, HOX4, HOX4GHox-4.7
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: HOXD1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSHVHYATSAVFSGGGSFLLSGQVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPGTYPKSVSPASGLPAAFSTFEW
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 3231
Target Species: Human
Isotype: IgG