Pescadillo Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255211-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255211 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Pescadillo
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
pescadillo homolog, pescadillo homolog 1, containing BRCT domain (zebrafish), PESpescadillo (zebrafish) homolog 1, containing BRCT domain
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PES1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RMEGKKPRVMAGTLKLEDKQRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIREANKLAEKRKAHDE
Quantity
100 μL
Research Discipline
Cancer, Cell Cycle and Replication
Gene ID (Entrez)
23481
Target Species
Human
Isotype
IgG
Related Products
Description
- Pescadillo Polyclonal specifically detects Pescadillo in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Pescadillo
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: pescadillo homolog, pescadillo homolog 1, containing BRCT domain (zebrafish), PESpescadillo (zebrafish) homolog 1, containing BRCT domain
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PES1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RMEGKKPRVMAGTLKLEDKQRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIREANKLAEKRKAHDE
Quantity: 100 μL
Research Discipline: Cancer, Cell Cycle and Replication
Gene ID (Entrez): 23481
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: pescadillo homolog, pescadillo homolog 1, containing BRCT domain (zebrafish), PESpescadillo (zebrafish) homolog 1, containing BRCT domain
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 23481
Target Species: __
Isotype: __
Antigen: ZDHHC16
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DHHC domain containing 16, EC 2.3.1, EC 2.3.1.-, zinc finger, DHHC-type containing 16
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ZDHHC16
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LFREAYAAIEKMKQLDKNKLQAVANQTYHQTPPPTFSFRERMTHK
Quantity: 100 μL
Research Discipline: Apoptosis
Gene ID (Entrez): 84287
Target Species: Human
Isotype: IgG