LMP2/PSMB9 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255229-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255229 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
LMP2/PSMB9
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
beta1i, LMP2MGC70470, Low molecular mass protein 2, Macropain chain 7, Multicatalytic endopeptidase complex chain 7, proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalpeptidase 2), proteasome catalytic subunit 1i, Proteasome chain 7, proteasome subunit beta 6i, proteasome subunit beta type-9, Proteasome subunit beta-1i, proteasome-related gene 2, PSMB6iproteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalprotease 2), Really interesting new gene 12 protein, RING12EC 3.4.25.1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
5698
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PSMB9
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGG
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- LMP2/PSMB9 Polyclonal specifically detects LMP2/PSMB9 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: LMP2/PSMB9
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: beta1i, LMP2MGC70470, Low molecular mass protein 2, Macropain chain 7, Multicatalytic endopeptidase complex chain 7, proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalpeptidase 2), proteasome catalytic subunit 1i, Proteasome chain 7, proteasome subunit beta 6i, proteasome subunit beta type-9, Proteasome subunit beta-1i, proteasome-related gene 2, PSMB6iproteasome (prosome, macropain) subunit, beta type, 9 (large multifunctionalprotease 2), Really interesting new gene 12 protein, RING12EC 3.4.25.1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 5698
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PSMB9
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGG
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: COPS4
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis), COP9 signalosome complex subunit 4, CSN4Arabidopsis, homolog) subunit 4, MANOP1, MGC10899, MGC15160
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 51138
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: COPS4
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis), COP9 signalosome complex subunit 4, CSN4Arabidopsis, homolog) subunit 4, MANOP1, MGC10899, MGC15160
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 51138
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: −20°C, avoid freeze-thaw cycles
