Cbl-c Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255259-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255259 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Cbl-c
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Cas-Br-M (murine) ecotropic retroviral transforming sequence c, Cas-Br-M (murine) ectropic retroviral transforming sequence c, CBL3, CBL-3, CBL-SL, RING finger protein 57, RNF57SH3-binding protein CBL-3, SH3-binding protein CBL-C, signal transduction protein CBL-C
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
CBLC
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGPGGPGGSGDFLLIYL
Quantity
100 μL
Research Discipline
Stem Cell Markers
Gene ID (Entrez)
23624
Target Species
Human
Isotype
IgG
Related Products
Description
- Cbl-c Polyclonal specifically detects Cbl-c in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Cbl-c
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Cas-Br-M (murine) ecotropic retroviral transforming sequence c, Cas-Br-M (murine) ectropic retroviral transforming sequence c, CBL3, CBL-3, CBL-SL, RING finger protein 57, RNF57SH3-binding protein CBL-3, SH3-binding protein CBL-C, signal transduction protein CBL-C
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CBLC
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGPGGPGGSGDFLLIYL
Quantity: 100 μL
Research Discipline: Stem Cell Markers
Gene ID (Entrez): 23624
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: Cas-Br-M (murine) ecotropic retroviral transforming sequence c, Cas-Br-M (murine) ectropic retroviral transforming sequence c, CBL3, CBL-3, CBL-SL, RING finger protein 57, RNF57SH3-binding protein CBL-3, SH3-binding protein CBL-C, signal transduction prot
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: −20°C, avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 23624
Target Species: __
Isotype: __
Antigen: NOL10
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: FLJ13938, FLJ14075, H_NH0074G24.1, nucleolar protein 10, polyglutamine binding protein 5, PQBP5
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NOL10
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QVSSLNEVKIYSLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVCTTIKVSKDGQYILATGTYKPRVRCYDTYQLSLKFERCL
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 79954
Target Species: Human
Isotype: IgG