HSD11B1L Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255319-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255319 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
HSD11B1L
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
11-beta-hydroxysteroid dehydrogenase type 3, 11-DH3, EC 1.1.1, EC 1.1.1.-, HSD3,11-beta-HSD3, hydroxysteroid (11-beta) dehydrogenase 1-like, hydroxysteroid 11-beta-dehydrogenase 1-like protein, SCDR10short chain dehydrogenase/reductase 10, SDR26C2, short chain dehydrogenase/reductase family 26C, member 2, Short-chain dehydrogenase/reductase 10
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
HSD11B1L
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DYLVLNHIGGAPAGTRARSPQATRWLMQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYS
Quantity
100 μL
Research Discipline
Lipid and Metabolism
Gene ID (Entrez)
374875
Target Species
Human
Isotype
IgG
Related Products
Description
- HSD11B1L Polyclonal specifically detects HSD11B1L in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: HSD11B1L
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 11-beta-hydroxysteroid dehydrogenase type 3, 11-DH3, EC 1.1.1, EC 1.1.1.-, HSD3,11-beta-HSD3, hydroxysteroid (11-beta) dehydrogenase 1-like, hydroxysteroid 11-beta-dehydrogenase 1-like protein, SCDR10short chain dehydrogenase/reductase 10, SDR26C2, short chain dehydrogenase/reductase family 26C, member 2, Short-chain dehydrogenase/reductase 10
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: HSD11B1L
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DYLVLNHIGGAPAGTRARSPQATRWLMQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYS
Quantity: 100 μL
Research Discipline: Lipid and Metabolism
Gene ID (Entrez): 374875
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: 11-beta-hydroxysteroid dehydrogenase type 3, 11-DH3, EC 1.1.1, EC 1.1.1.-, HSD3,11-beta-HSD3, hydroxysteroid (11-beta) dehydrogenase 1-like, hydroxysteroid 11-beta-dehydrogenase 1-like protein, SCDR10short chain dehydrogenase/reductase 10, SDR26C2, short
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 374875
Target Species: __
Isotype: __
Antigen: TWA1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: bA305P22.1, C20orf11, chromosome 20 open reading frame 11, FLJ20602, GID complex subunit 8 homolog (S. cerevisiae), Twa1, TWA1protein C20orf11, two hybrid associated protein 1, Two hybrid-associated protein 1 with RanBPM
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: GID8
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLSKGVIE
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 54994
Target Species: Human
Isotype: IgG