Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255797-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255797 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Aldehyde Dehydrogenase 3-A1/ALDH3A1
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Aldehyde dehydrogenase 3, aldehyde dehydrogenase 3 family, member A1, Aldehyde dehydrogenase family 3 member A1, aldehyde dehydrogenase isozyme 3, aldehyde dehydrogenase type III, ALDH3aldehyde dehydrogenase, dimeric NADP-preferring, ALDHIII, EC 1.2.1, EC 1.2.1.5, MGC10406, stomach aldehyde dehydrogenase
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ALDH3A1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPL
Quantity
100 μL
Research Discipline
Vision
Gene ID (Entrez)
218
Target Species
Human
Isotype
IgG
Related Products
Description
- Aldehyde Dehydrogenase 3-A1/ALDH3A1 Polyclonal specifically detects Aldehyde Dehydrogenase 3-A1/ALDH3A1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Aldehyde Dehydrogenase 3-A1/ALDH3A1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Aldehyde dehydrogenase 3, aldehyde dehydrogenase 3 family, member A1, Aldehyde dehydrogenase family 3 member A1, aldehyde dehydrogenase isozyme 3, aldehyde dehydrogenase type III, ALDH3aldehyde dehydrogenase, dimeric NADP-preferring, ALDHIII, EC 1.2.1, EC 1.2.1.5, MGC10406, stomach aldehyde dehydrogenase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ALDH3A1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPL
Quantity: 100 μL
Research Discipline: Vision
Gene ID (Entrez): 218
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: Aldehyde dehydrogenase 3, aldehyde dehydrogenase 3 family, member A1, Aldehyde dehydrogenase family 3 member A1, aldehyde dehydrogenase isozyme 3, aldehyde dehydrogenase type III, ALDH3aldehyde dehydrogenase, dimeric NADP-preferring, ALDHIII, EC 1.2.1, EC
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 218
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: solute carrier family 18 (vesicular monoamine), member 1
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 6570
Target Species: __
Isotype: __
