NBP255797PE
Novus Biologicals™ Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255797PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255797PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
218
Common Name
Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
Aldehyde dehydrogenase 3, aldehyde dehydrogenase 3 family, member A1, Aldehyde dehydrogenase family 3 member A1, aldehyde dehydrogenase isozyme 3, aldehyde dehydrogenase type III, ALDH3aldehyde dehydrogenase, dimeric NADP-preferring, ALDHIII, EC 1.2.1, EC
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ALDH3A1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50588. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Aldehyde Dehydrogenase 3-A1/ALDH3A1
- Source: E.coli Amino Acid Sequence: LHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPL The Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen is derived from E
- coli
- The Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 218
Common Name: Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Aldehyde dehydrogenase 3, aldehyde dehydrogenase 3 family, member A1, Aldehyde dehydrogenase family 3 member A1, aldehyde dehydrogenase isozyme 3, aldehyde dehydrogenase type III, ALDH3aldehyde dehydrogenase, dimeric NADP-preferring, ALDHIII, EC 1.2.1, EC
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ALDH3A1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50588. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
218
Common Name:
Aldehyde Dehydrogenase 3-A1/ALDH3A1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Aldehyde dehydrogenase 3, aldehyde dehydrogenase 3 family, member A1, Aldehyde dehydrogenase family 3 member A1, aldehyde dehydrogenase isozyme 3, aldehyde dehydrogenase type III, ALDH3aldehyde dehydrogenase, dimeric NADP-preferring, ALDHIII, EC 1.2.1, EC
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ALDH3A1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50588. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 6570
Common Name: VMAT1/SLC18A1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: solute carrier family 18 (vesicular monoamine), member 1
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SLC18A1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52722. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6570
Common Name:
VMAT1/SLC18A1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
solute carrier family 18 (vesicular monoamine), member 1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SLC18A1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52722. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 29952
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: carboxytripeptidase, Dipeptidyl aminopeptidase II, dipeptidyl arylamidase II, dipeptidyl peptidase 2, Dipeptidyl peptidase 7, Dipeptidyl peptidase II, dipeptidylpeptidase 7, dipeptidyl-peptidase 7, dipeptidyl-peptidase II, DPP II, DPP2, DPPII, EC 3.4.14.2, QPP, Quiescent cell proline dipeptidase
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
29952
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
carboxytripeptidase, Dipeptidyl aminopeptidase II, dipeptidyl arylamidase II, dipeptidyl peptidase 2, Dipeptidyl peptidase 7, Dipeptidyl peptidase II, dipeptidylpeptidase 7, dipeptidyl-peptidase 7, dipeptidyl-peptidase II, DPP II, DPP2, DPPII, EC 3.4.14.2, QPP, Quiescent cell proline dipeptidase
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 29952
Common Name: DPPII/QPP/DPP7 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: carboxytripeptidase, Dipeptidyl aminopeptidase II, dipeptidyl arylamidase II, dipeptidyl peptidase 2, Dipeptidyl peptidase 7, Dipeptidyl peptidase II, dipeptidylpeptidase 7, dipeptidyl-peptidase 7, dipeptidyl-peptidase II, DPP II, DPP2, DPPII, EC 3.4.14.2
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DPP7
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52346. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
29952
Common Name:
DPPII/QPP/DPP7 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
carboxytripeptidase, Dipeptidyl aminopeptidase II, dipeptidyl arylamidase II, dipeptidyl peptidase 2, Dipeptidyl peptidase 7, Dipeptidyl peptidase II, dipeptidylpeptidase 7, dipeptidyl-peptidase 7, dipeptidyl-peptidase II, DPP II, DPP2, DPPII, EC 3.4.14.2
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
DPP7
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52346. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml