NBP256464PE
Novus Biologicals™ ALDH1A3 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256464PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256464PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
220
Common Name
ALDH1A3 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
aldehyde dehydrogenase 1 family, member A3, Aldehyde dehydrogenase 6, aldehyde dehydrogenase family 1 member A3, ALDH1A6, ALDH6acetaldehyde dehydrogenase 6, EC 1.2.1, EC 1.2.1.5, RalDH3, RALDH-3, Retinaldehyde dehydrogenase 3
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ALDH1A3
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52808. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALDH1A3
- Source: E.coli Amino Acid Sequence: TLAALETMDTGKPFLHAFFIDLEGCIRTLRYF The ALDH1A3 Recombinant Protein Antigen is derived from E
- coli
- The ALDH1A3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 220
Common Name: ALDH1A3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: aldehyde dehydrogenase 1 family, member A3, Aldehyde dehydrogenase 6, aldehyde dehydrogenase family 1 member A3, ALDH1A6, ALDH6acetaldehyde dehydrogenase 6, EC 1.2.1, EC 1.2.1.5, RalDH3, RALDH-3, Retinaldehyde dehydrogenase 3
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ALDH1A3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52808. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
220
Common Name:
ALDH1A3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
aldehyde dehydrogenase 1 family, member A3, Aldehyde dehydrogenase 6, aldehyde dehydrogenase family 1 member A3, ALDH1A6, ALDH6acetaldehyde dehydrogenase 6, EC 1.2.1, EC 1.2.1.5, RalDH3, RALDH-3, Retinaldehyde dehydrogenase 3
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ALDH1A3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52808. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 115201
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: APG4 autophagy 4 homolog A (S. cerevisiae), APG4A, ATG4 autophagy related 4 homolog A (S. cerevisiae), AUTL2, AUT-like 2 cysteine endopeptidase, AUT-like 2, cysteine endopeptidase (S. cerevisiae), autophagin 2, autophagin-2, cysteine endopeptidase, cysteine protease ATG4A, EC 3.4.22, EC 3.4.22.-, hAPG4A
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
115201
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
APG4 autophagy 4 homolog A (S. cerevisiae), APG4A, ATG4 autophagy related 4 homolog A (S. cerevisiae), AUTL2, AUT-like 2 cysteine endopeptidase, AUT-like 2, cysteine endopeptidase (S. cerevisiae), autophagin 2, autophagin-2, cysteine endopeptidase, cysteine protease ATG4A, EC 3.4.22, EC 3.4.22.-, hAPG4A
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 115201
Common Name: ATG4A Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: APG4 autophagy 4 homolog A (S. cerevisiae), APG4A, ATG4 autophagy related 4 homolog A (S. cerevisiae), AUTL2, AUT-like 2 cysteine endopeptidase, AUT-like 2, cysteine endopeptidase (S. cerevisiae), autophagin 2, autophagin-2, cysteine endopeptidase, cystei
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ATG4A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50649. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
115201
Common Name:
ATG4A Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
APG4 autophagy 4 homolog A (S. cerevisiae), APG4A, ATG4 autophagy related 4 homolog A (S. cerevisiae), AUTL2, AUT-like 2 cysteine endopeptidase, AUT-like 2, cysteine endopeptidase (S. cerevisiae), autophagin 2, autophagin-2, cysteine endopeptidase, cystei
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ATG4A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50649. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 29887
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: MGC33054, sorting nexin 10, sorting nexin-10
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
29887
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
MGC33054, sorting nexin 10, sorting nexin-10
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__