ATG4A Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256465-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP256465 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
ATG4A
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
APG4 autophagy 4 homolog A (S. cerevisiae), APG4A, ATG4 autophagy related 4 homolog A (S. cerevisiae), AUTL2, AUT-like 2 cysteine endopeptidase, AUT-like 2, cysteine endopeptidase (S. cerevisiae), autophagin 2, autophagin-2, cysteine endopeptidase, cysteine protease ATG4A, EC 3.4.22, EC 3.4.22.-, hAPG4A
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ATG4A
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTG
Quantity
100 μL
Research Discipline
Autophagy
Gene ID (Entrez)
115201
Target Species
Human
Isotype
IgG
Related Products
Description
- ATG4A Polyclonal specifically detects ATG4A in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ATG4A
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: APG4 autophagy 4 homolog A (S. cerevisiae), APG4A, ATG4 autophagy related 4 homolog A (S. cerevisiae), AUTL2, AUT-like 2 cysteine endopeptidase, AUT-like 2, cysteine endopeptidase (S. cerevisiae), autophagin 2, autophagin-2, cysteine endopeptidase, cysteine protease ATG4A, EC 3.4.22, EC 3.4.22.-, hAPG4A
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ATG4A
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTG
Quantity: 100 μL
Research Discipline: Autophagy
Gene ID (Entrez): 115201
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: APG4 autophagy 4 homolog A (S. cerevisiae), APG4A, ATG4 autophagy related 4 homolog A (S. cerevisiae), AUTL2, AUT-like 2 cysteine endopeptidase, AUT-like 2, cysteine endopeptidase (S. cerevisiae), autophagin 2, autophagin-2, cysteine endopeptidase, cystei
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 115201
Target Species: __
Isotype: __
Antigen: SNX10
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: MGC33054, sorting nexin 10, sorting nexin-10
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SNX10
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MFPEQQKEEFVSVWVRDPRIQKEDFWHSYIDYEICIHTNSMCFTMKTSCV
Quantity: 100 μL
Research Discipline: Signal Transduction
Gene ID (Entrez): 29887
Target Species: Human
Isotype: IgG