NBP256093PE
Novus Biologicals™ Adenylate Kinase 6 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256093PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256093PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Common Name
Adenylate Kinase 6 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Symbol
AK6
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51258. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Adenylate Kinase 6
- Source: E.coli Amino Acid Sequence: TNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIE The Adenylate Kinase 6 Recombinant Protein Antigen is derived from E
- coli
- The Adenylate Kinase 6 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Common Name: Adenylate Kinase 6 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbol: AK6
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51258. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Common Name:
Adenylate Kinase 6 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Symbol:
AK6
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51258. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Label Type: __
Quantity: 100 μL
Source: __
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Label Type:
__
Quantity:
100 μL
Source:
__
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Common Name: PERQ2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbol: GIGYF2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51941. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Common Name:
PERQ2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Symbol:
GIGYF2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51941. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Common Name: GM-CSF Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbol: CSF2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52542. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Common Name:
GM-CSF Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Symbol:
CSF2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52542. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml