PERQ2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256094-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256094 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PERQ2
Classification
Polyclonal
Dilution
Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias
DKFZp686J17223, FLJ23368, GRB10 interacting GYF protein 2, GRB10-interacting GYF protein 2, GYF domain containing 2, GYF2, KIAA0642DKFZp686I15154, PARK11, Parkinson disease (autosomal recessive, early onset) 11, PERQ amino acid rich, with GYF domain 2, PERQ amino acid rich, with GYF domain 3, PERQ amino acid-rich with GYF domain-containing protein 2, PERQ2, PERQ3, TNRC15, trinucleotide repeat containing 15, Trinucleotide repeat-containing gene 15 protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
26058
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
GIGYF2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QHQQPNRARNNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNK
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- PERQ2 Polyclonal specifically detects PERQ2 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: PERQ2
Classification: Polyclonal
Dilution: Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: DKFZp686J17223, FLJ23368, GRB10 interacting GYF protein 2, GRB10-interacting GYF protein 2, GYF domain containing 2, GYF2, KIAA0642DKFZp686I15154, PARK11, Parkinson disease (autosomal recessive, early onset) 11, PERQ amino acid rich, with GYF domain 2, PERQ amino acid rich, with GYF domain 3, PERQ amino acid-rich with GYF domain-containing protein 2, PERQ2, PERQ3, TNRC15, trinucleotide repeat containing 15, Trinucleotide repeat-containing gene 15 protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 26058
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: GIGYF2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QHQQPNRARNNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNK
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: DKFZp686J17223, FLJ23368, GRB10 interacting GYF protein 2, GRB10-interacting GYF protein 2, GYF domain containing 2, GYF2, KIAA0642DKFZp686I15154, PARK11, Parkinson disease (autosomal recessive, early onset) 11, PERQ amino acid rich, with GYF domain 2, PE
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 26058
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: colony stimulating factor 2 (granulocyte-macrophage), Colony-stimulating factor, CSF, GM-CSF, GMCSFgranulocyte-macrophage colony-stimulating factor, granulocyte-macrophage colony stimulating factor, MGC131935, MGC138897, molgramostin, sargramostim
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 1437
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
