PERQ2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256856-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256856 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PERQ2
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
DKFZp686J17223, FLJ23368, GRB10 interacting GYF protein 2, GRB10-interacting GYF protein 2, GYF domain containing 2, GYF2, KIAA0642DKFZp686I15154, PARK11, Parkinson disease (autosomal recessive, early onset) 11, PERQ amino acid rich, with GYF domain 2, PERQ amino acid rich, with GYF domain 3, PERQ amino acid-rich with GYF domain-containing protein 2, PERQ2, PERQ3, TNRC15, trinucleotide repeat containing 15, Trinucleotide repeat-containing gene 15 protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
26058
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
GIGYF2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QHQQPNRARNNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNK
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- PERQ2 Polyclonal specifically detects PERQ2 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PERQ2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DKFZp686J17223, FLJ23368, GRB10 interacting GYF protein 2, GRB10-interacting GYF protein 2, GYF domain containing 2, GYF2, KIAA0642DKFZp686I15154, PARK11, Parkinson disease (autosomal recessive, early onset) 11, PERQ amino acid rich, with GYF domain 2, PERQ amino acid rich, with GYF domain 3, PERQ amino acid-rich with GYF domain-containing protein 2, PERQ2, PERQ3, TNRC15, trinucleotide repeat containing 15, Trinucleotide repeat-containing gene 15 protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 26058
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: GIGYF2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QHQQPNRARNNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNK
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: baculoviral IAP repeat containing 7, baculoviral IAP repeat-containing 7, KIAPRING finger protein 50, Kidney inhibitor of apoptosis protein, Livin, livin inhibitor-of-apoptosis, Melanoma inhibitor of apoptosis protein, MLIAPlivin inhibitor of apoptosis, M
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 79444
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: coiled-coil domain containing 65, coiled-coil domain-containing protein 65, FLJ25663, FLJ35732, NYD-SP28, Testis development protein NYD-SP28
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 85478
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.