FAPP2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255932-Each-of-1 | In Stock | ₹ 55,847.50 |
NBP255932 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,847.50
GST (18%): ₹ 10,052.55
Total Price: ₹ 65,900.05
Antigen
FAPP2
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
DKFZp313M1034, DKFZp686J09164, FAPP-2, FAPP2MGC3358, hFAPP2, PH domain-containing family A member 8, Phosphatidylinositol-four-phosphate adapter protein 2, Phosphoinositol 4-phosphate adapter protein 2, pleckstrin homology domain containing, family A (phosphoinositide bindingspecific) member 8, pleckstrin homology domain-containing family A member 8, Serologically defined breast cancer antigen NY-BR-86
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
84725
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PLEKHA8
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TSELLYRTPPGSPQLAMLKSSKMKHPIIPIHNSLERQMELSTCENGSLNMEINGEEEILMKNKNSLYLKSAEIDCSISSEENTDDNITVQGEIMK
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- FAPP2 Polyclonal specifically detects FAPP2 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: FAPP2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DKFZp313M1034, DKFZp686J09164, FAPP-2, FAPP2MGC3358, hFAPP2, PH domain-containing family A member 8, Phosphatidylinositol-four-phosphate adapter protein 2, Phosphoinositol 4-phosphate adapter protein 2, pleckstrin homology domain containing, family A (phosphoinositide bindingspecific) member 8, pleckstrin homology domain-containing family A member 8, Serologically defined breast cancer antigen NY-BR-86
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 84725
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PLEKHA8
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TSELLYRTPPGSPQLAMLKSSKMKHPIIPIHNSLERQMELSTCENGSLNMEINGEEEILMKNKNSLYLKSAEIDCSISSEENTDDNITVQGEIMK
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: DKFZp313M1034, DKFZp686J09164, FAPP-2, FAPP2MGC3358, hFAPP2, PH domain-containing family A member 8, Phosphatidylinositol-four-phosphate adapter protein 2, Phosphoinositol 4-phosphate adapter protein 2, pleckstrin homology domain containing, family A (pho
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 84725
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Antigen: TAP1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: ABC transporter, MHC 1, ABCB2FLJ41500, antigen peptide transporter 1, APT1, ATP-binding cassette sub-family B member 2, ATP-binding cassette, sub-family B (MDR/TAP), member 2, D6S114E, Peptide supply factor 1, Peptide transporter involved in antigen processing 1, Peptide transporter PSF1, Peptide transporter TAP1, PSF-1, PSF1ABC17, Really interesting new gene 4 protein, RING4FLJ26666, TAP1*0102N, TAP1N, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP), transporter associated with antigen processing, transporter, ATP-binding cassette, major histocompatibility complex, 1, Y3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 6890
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TAP1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEK
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.