NBP255932PE
Novus Biologicals™ FAPP2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255932PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255932PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
84725
Common Name
FAPP2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
DKFZp313M1034, DKFZp686J09164, FAPP-2, FAPP2MGC3358, hFAPP2, PH domain-containing family A member 8, Phosphatidylinositol-four-phosphate adapter protein 2, Phosphoinositol 4-phosphate adapter protein 2, pleckstrin homology domain containing, family A (pho
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PLEKHA8
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53350. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FAPP2
- Source: E.coli Amino Acid Sequence: TSELLYRTPPGSPQLAMLKSSKMKHPIIPIHNSLERQMELSTCENGSLNMEINGEEEILMKNKNSLYLKSAEIDCSISSEENTDDNITVQGEIMK The FAPP2 Recombinant Protein Antigen is derived from E
- coli
- The FAPP2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 84725
Common Name: FAPP2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: DKFZp313M1034, DKFZp686J09164, FAPP-2, FAPP2MGC3358, hFAPP2, PH domain-containing family A member 8, Phosphatidylinositol-four-phosphate adapter protein 2, Phosphoinositol 4-phosphate adapter protein 2, pleckstrin homology domain containing, family A (pho
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PLEKHA8
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53350. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
84725
Common Name:
FAPP2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
DKFZp313M1034, DKFZp686J09164, FAPP-2, FAPP2MGC3358, hFAPP2, PH domain-containing family A member 8, Phosphatidylinositol-four-phosphate adapter protein 2, Phosphoinositol 4-phosphate adapter protein 2, pleckstrin homology domain containing, family A (pho
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PLEKHA8
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53350. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 6890
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: ABC transporter, MHC 1, ABCB2FLJ41500, antigen peptide transporter 1, APT1, ATP-binding cassette sub-family B member 2, ATP-binding cassette, sub-family B (MDR/TAP), member 2, D6S114E, Peptide supply factor 1, Peptide transporter involved in antigen processing 1, Peptide transporter PSF1, Peptide transporter TAP1, PSF-1, PSF1ABC17, Really interesting new gene 4 protein, RING4FLJ26666, TAP1*0102N, TAP1N, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP), transporter associated with antigen processing, transporter, ATP-binding cassette, major histocompatibility complex, 1, Y3
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
6890
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
ABC transporter, MHC 1, ABCB2FLJ41500, antigen peptide transporter 1, APT1, ATP-binding cassette sub-family B member 2, ATP-binding cassette, sub-family B (MDR/TAP), member 2, D6S114E, Peptide supply factor 1, Peptide transporter involved in antigen processing 1, Peptide transporter PSF1, Peptide transporter TAP1, PSF-1, PSF1ABC17, Really interesting new gene 4 protein, RING4FLJ26666, TAP1*0102N, TAP1N, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP), transporter associated with antigen processing, transporter, ATP-binding cassette, major histocompatibility complex, 1, Y3
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 6890
Common Name: TAP1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: ABC transporter, MHC 1, ABCB2FLJ41500, antigen peptide transporter 1, APT1, ATP-binding cassette sub-family B member 2, ATP-binding cassette, sub-family B (MDR/TAP), member 2, D6S114E, Peptide supply factor 1, Peptide transporter involved in antigen proce
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TAP1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53352.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6890
Common Name:
TAP1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
ABC transporter, MHC 1, ABCB2FLJ41500, antigen peptide transporter 1, APT1, ATP-binding cassette sub-family B member 2, ATP-binding cassette, sub-family B (MDR/TAP), member 2, D6S114E, Peptide supply factor 1, Peptide transporter involved in antigen proce
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TAP1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53352.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 2256
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: FGF-11, FHF-3, FHF3Fibroblast growth factor homologous factor 3, fibroblast growth factor 11, FLJ16061, MGC102953, MGC45269
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
2256
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
FGF-11, FHF-3, FHF3Fibroblast growth factor homologous factor 3, fibroblast growth factor 11, FLJ16061, MGC102953, MGC45269
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__