NBP255908PE
Novus Biologicals™ THAP8 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255908PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255908PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
199745
Common Name
THAP8 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
FLJ32891, THAP domain containing 8, THAP domain-containing protein 8
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
THAP8
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50600. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human THAP8
- Source: E.coli Amino Acid Sequence: MPKYCRAPNCSNTAGRLGADNRPVSFYKFPLKDGPRLQAWLQHMGCEHWVPSCHQHLCSEHFTPS The THAP8 Recombinant Protein Antigen is derived from E
- coli
- The THAP8 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 199745
Common Name: THAP8 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: FLJ32891, THAP domain containing 8, THAP domain-containing protein 8
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: THAP8
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50600. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
199745
Common Name:
THAP8 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
FLJ32891, THAP domain containing 8, THAP domain-containing protein 8
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
THAP8
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50600. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 129684
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: caspr5, Cell recognition molecule Caspr5, contactin associated protein-like 5, contactin-associated protein-like 5, FLJ31966
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
129684
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
caspr5, Cell recognition molecule Caspr5, contactin associated protein-like 5, contactin-associated protein-like 5, FLJ31966
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 129684
Common Name: CNTNAP5 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: caspr5, Cell recognition molecule Caspr5, contactin associated protein-like 5, contactin-associated protein-like 5, FLJ31966
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CNTNAP5
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53137. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
129684
Common Name:
CNTNAP5 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
caspr5, Cell recognition molecule Caspr5, contactin associated protein-like 5, contactin-associated protein-like 5, FLJ31966
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CNTNAP5
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53137. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 92689
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: family with sequence similarity 114, member A1, FLJ33151, nervous system over expressed protein 20, Nervous system over-expressed protein 20, NOXP20, Protein FAM114A1, protein NOXP20
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
92689
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
family with sequence similarity 114, member A1, FLJ33151, nervous system over expressed protein 20, Nervous system over-expressed protein 20, NOXP20, Protein FAM114A1, protein NOXP20
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__