NBP256153PE
Novus Biologicals™ GAPDH Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256153PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256153PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
2597
Common Name
GAPDH Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
aging-associated gene 9 protein, EC 1.2.1, EC 1.2.1.12, EC 2.6.99.-, G3PD, GAPD, glyceraldehyde 3-phosphate dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, MGC88685, Peptidyl-cysteine S-nitrosylase GAPDH
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
GAPDH
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50471. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GAPDH
- Source: E.coli Amino Acid Sequence: EKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAG The GAPDH Recombinant Protein Antigen is derived from E
- coli
- The GAPDH Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 2597
Common Name: GAPDH Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: aging-associated gene 9 protein, EC 1.2.1, EC 1.2.1.12, EC 2.6.99.-, G3PD, GAPD, glyceraldehyde 3-phosphate dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, MGC88685, Peptidyl-cysteine S-nitrosylase GAPDH
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: GAPDH
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50471. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
2597
Common Name:
GAPDH Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
aging-associated gene 9 protein, EC 1.2.1, EC 1.2.1.12, EC 2.6.99.-, G3PD, GAPD, glyceraldehyde 3-phosphate dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, MGC88685, Peptidyl-cysteine S-nitrosylase GAPDH
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
GAPDH
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50471. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 10189
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Ally of AML-1 and LEF-1, ALY/REF, ALYBEFbZIP enhancing factor, bZIP-enhancing factor BEF, REF, THO complex 4, THO complex subunit 4, tho4, Transcriptional coactivator Aly/REF
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
10189
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Ally of AML-1 and LEF-1, ALY/REF, ALYBEFbZIP enhancing factor, bZIP-enhancing factor BEF, REF, THO complex 4, THO complex subunit 4, tho4, Transcriptional coactivator Aly/REF
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 10189
Common Name: Aly Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Ally of AML-1 and LEF-1, ALY/REF, ALYBEFbZIP enhancing factor, bZIP-enhancing factor BEF, REF, THO complex 4, THO complex subunit 4, tho4, Transcriptional coactivator Aly/REF
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ALYREF
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50472. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
10189
Common Name:
Aly Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Ally of AML-1 and LEF-1, ALY/REF, ALYBEFbZIP enhancing factor, bZIP-enhancing factor BEF, REF, THO complex 4, THO complex subunit 4, tho4, Transcriptional coactivator Aly/REF
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ALYREF
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50472. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 320
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Adapter protein X11alpha, amyloid beta (A4) precursor protein-binding, family A, member 1, amyloid beta A4 precursor protein-binding family A member 1, D9S411Eadaptor protein X11alpha, LIN10, Mint-1, MINT1amyloid beta (A4) precursor protein-binding, family A, member 1 (X11), Neuronal Munc18-1-interacting protein 1, Neuron-specific X11 protein, phosphotyrosine-binding/-interacting domain (PTB)-bearing protein, UROP11, X11A, X11X11ALPHA
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
320
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Adapter protein X11alpha, amyloid beta (A4) precursor protein-binding, family A, member 1, amyloid beta A4 precursor protein-binding family A member 1, D9S411Eadaptor protein X11alpha, LIN10, Mint-1, MINT1amyloid beta (A4) precursor protein-binding, family A, member 1 (X11), Neuronal Munc18-1-interacting protein 1, Neuron-specific X11 protein, phosphotyrosine-binding/-interacting domain (PTB)-bearing protein, UROP11, X11A, X11X11ALPHA
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__