APBA1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256155-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256155 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
APBA1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Adapter protein X11alpha, amyloid beta (A4) precursor protein-binding, family A, member 1, amyloid beta A4 precursor protein-binding family A member 1, D9S411Eadaptor protein X11alpha, LIN10, Mint-1, MINT1amyloid beta (A4) precursor protein-binding, family A, member 1 (X11), Neuronal Munc18-1-interacting protein 1, Neuron-specific X11 protein, phosphotyrosine-binding/-interacting domain (PTB)-bearing protein, UROP11, X11A, X11X11ALPHA
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
APBA1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGEDEPYSEPYADYGGLQEHVYEEIGDAPELDARDGLRLYEQERDE
Quantity
100 μL
Research Discipline
Membrane Trafficking and Chaperones, Vision
Gene ID (Entrez)
320
Target Species
Human
Isotype
IgG
Related Products
Description
- APBA1 Polyclonal specifically detects APBA1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: APBA1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Adapter protein X11alpha, amyloid beta (A4) precursor protein-binding, family A, member 1, amyloid beta A4 precursor protein-binding family A member 1, D9S411Eadaptor protein X11alpha, LIN10, Mint-1, MINT1amyloid beta (A4) precursor protein-binding, family A, member 1 (X11), Neuronal Munc18-1-interacting protein 1, Neuron-specific X11 protein, phosphotyrosine-binding/-interacting domain (PTB)-bearing protein, UROP11, X11A, X11X11ALPHA
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: APBA1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGEDEPYSEPYADYGGLQEHVYEEIGDAPELDARDGLRLYEQERDE
Quantity: 100 μL
Research Discipline: Membrane Trafficking and Chaperones, Vision
Gene ID (Entrez): 320
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: EC 3.-, HINT-2, HINT-3, histidine triad nucleotide binding protein 2, histidine triad nucleotide-binding protein 2, mitochondrial, HIT-17, HIT-17kDa, PKCI-1-related HIT protein, protein kinase C inhibitor-2
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 84681
Target Species: __
Isotype: __
Antigen: EXOC6
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DKFZp761I2124, EXOC6A, exocyst complex component 6, Exocyst complex component Sec15A, FLJ1125, FLJ11251, MGC33397, SEC15A, SEC15L1SEC15-like 1 (S. cerevisiae), SEC15L3, SEC15-like 1, SEC15-like protein 1, SEC15-like protein 3, SEC15LSEC15, Sec15p
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: EXOC6
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLREDIKEI
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 54536
Target Species: Human
Isotype: IgG