TWA1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255320-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255320 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
TWA1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
bA305P22.1, C20orf11, chromosome 20 open reading frame 11, FLJ20602, GID complex subunit 8 homolog (S. cerevisiae), Twa1, TWA1protein C20orf11, two hybrid associated protein 1, Two hybrid-associated protein 1 with RanBPM
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
54994
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
GID8
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLSKGVIE
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- TWA1 Polyclonal specifically detects TWA1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: TWA1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: bA305P22.1, C20orf11, chromosome 20 open reading frame 11, FLJ20602, GID complex subunit 8 homolog (S. cerevisiae), Twa1, TWA1protein C20orf11, two hybrid associated protein 1, Two hybrid-associated protein 1 with RanBPM
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 54994
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: GID8
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FDSPEESPFGDLLHTMQRQKVWSEVNQAVLDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLSKGVIE
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: bA305P22.1, C20orf11, chromosome 20 open reading frame 11, FLJ20602, GID complex subunit 8 homolog (S. cerevisiae), Twa1, TWA1protein C20orf11, two hybrid associated protein 1, Two hybrid-associated protein 1 with RanBPM
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 54994
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Antigen: __
Classification: __
Dilution: __
Gene Alias: ACPIN1, C7orf70, Chromosome 7 Open Reading Frame 70, Family With Sequence Similarity 220 Member A, Family With Sequence Similarity 220, Member A, Protein FAM220A, SIPAR, STAT3-Interacting Protein As A Repressor
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 84792
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
