BRF1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255335-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255335 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
BRF1
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
Gene Alias
B-related factor 1, BRF-1, BRF1 homolog, subunit of RNA polymerase III transcription initiation factorIIIB (S. cerevisiae), BRFFLJ42674, general transcription factor IIIB, 90kD subunit, GTF3BTAFIII90, hBRFMGC105048, hTFIIIB90, TAF3B2, TAF3CB - related factor 1, TATA box binding protein (TBP)-associated factor 3C, TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3Bsubunit 2, TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2, TATA box-binding protein-associated factor, RNA polymerase III, subunit 2, TBP - associated factor, RNA polymerase III, 90kD, TF3B90, TFIIIB90FLJ43034, transcription factor IIIB 90 kDa subunit
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
2972
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
BRF1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAKDGSTEDTASSLCGEEDTEDEELEAAASHLNKDL
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Description
- BRF1 Polyclonal specifically detects BRF1 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: BRF1
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
Gene Alias: B-related factor 1, BRF-1, BRF1 homolog, subunit of RNA polymerase III transcription initiation factorIIIB (S. cerevisiae), BRFFLJ42674, general transcription factor IIIB, 90kD subunit, GTF3BTAFIII90, hBRFMGC105048, hTFIIIB90, TAF3B2, TAF3CB - related factor 1, TATA box binding protein (TBP)-associated factor 3C, TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3Bsubunit 2, TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2, TATA box-binding protein-associated factor, RNA polymerase III, subunit 2, TBP - associated factor, RNA polymerase III, 90kD, TF3B90, TFIIIB90FLJ43034, transcription factor IIIB 90 kDa subunit
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 2972
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: BRF1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAKDGSTEDTASSLCGEEDTEDEELEAAASHLNKDL
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: B-related factor 1, BRF-1, BRF1 homolog, subunit of RNA polymerase III transcription initiation factorIIIB (S. cerevisiae), BRFFLJ42674, general transcription factor IIIB, 90kD subunit, GTF3BTAFIII90, hBRFMGC105048, hTFIIIB90, TAF3B2, TAF3CB - related fac
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 2972
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: −20°C, avoid freeze-thaw cycles
Antigen: INSM2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: insulinoma-associated 2, Nbla106, zinc finger protein IA-6
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 84684
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: INSM2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AEGKENSRIERTADQHPQARDSSGADQHPDSAPRQGLQVLTHPEPPLPQGPYTEGVLGRRVPVPGSTSGGRGSEIFVCP
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.