FANCM Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255444-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255444 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
FANCM
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
ATP-dependent RNA helicase FANCM, EC 3.6.1, FAAP250EC 3.6.4.13, Fanconi anemia, complementation group M, Fanconi anemia-associated polypeptide of 250 kDa, KIAA1596Fanconi anemia group M protein, MGC176453, Protein FACM, Protein Hef ortholog
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
FANCM
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAGTHTSLRLPQEGKGTCILVGGHEITSGLEVISSLRAIHGLQVEVCPLNGCDYIVSNRMVVERRSQSEMLNSVNKNKFIEQIQH
Quantity
100 μL
Research Discipline
DNA Repair, Epigenetics
Gene ID (Entrez)
57697
Target Species
Human
Isotype
IgG
Related Products
Description
- FANCM Polyclonal specifically detects FANCM in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: FANCM
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: ATP-dependent RNA helicase FANCM, EC 3.6.1, FAAP250EC 3.6.4.13, Fanconi anemia, complementation group M, Fanconi anemia-associated polypeptide of 250 kDa, KIAA1596Fanconi anemia group M protein, MGC176453, Protein FACM, Protein Hef ortholog
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: FANCM
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAGTHTSLRLPQEGKGTCILVGGHEITSGLEVISSLRAIHGLQVEVCPLNGCDYIVSNRMVVERRSQSEMLNSVNKNKFIEQIQH
Quantity: 100 μL
Research Discipline: DNA Repair, Epigenetics
Gene ID (Entrez): 57697
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: BCM1 surface antigen, BCM1Leukocyte antigen MEM-102, BLAST, BLAST1TCT.1, B-lymphocyte activation marker BLAST-1, CD48 antigen, CD48 antigen (B-cell membrane protein), CD48 molecule, hCD48, mCD48, MEM-102, SLAMF2
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 962
Target Species: __
Isotype: __
Antigen: WHSC2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: FLJ10442, negative elongation factor A, NELFA, NELF-AFLJ25112, Wolf-Hirschhorn syndrome candidate 2, Wolf-Hirschhorn syndrome candidate 2 protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: WHSC2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DTGSLNLELEEQNPNVQDILGELREKVGECEASAMLPLECQYLNKNALTTLAGPLTPPVKHFQLKRKPKSATLRAELLQKSTET
Quantity: 100 μL
Research Discipline: Cancer
Gene ID (Entrez): 7469
Target Species: Human
Isotype: IgG