PITX2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255572-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP255572 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
PITX2
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
all1-responsive gene 1, ALL1-responsive protein ARP1, ARP1MGC20144, Homeobox protein PITX2, IDG2, IGDS, IGDS2, IHG2, IRID2, Otlx2, paired-like homeodomain 2, Paired-like homeodomain transcription factor 2MGC111022, pituitary homeo box 2, pituitary homeobox 2, PTX2, RGSRIEG1Brx1, RIEG, RIEG bicoid-related homeobox transcription factor, rieg bicoid-related homeobox transcription factor 1, RS, solurshin
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PITX2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKR
Quantity
100 μL
Research Discipline
Stem Cell Markers
Gene ID (Entrez)
5308
Target Species
Human
Isotype
IgG
Related Products
Description
- PITX2 Polyclonal specifically detects PITX2 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PITX2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: all1-responsive gene 1, ALL1-responsive protein ARP1, ARP1MGC20144, Homeobox protein PITX2, IDG2, IGDS, IGDS2, IHG2, IRID2, Otlx2, paired-like homeodomain 2, Paired-like homeodomain transcription factor 2MGC111022, pituitary homeo box 2, pituitary homeobox 2, PTX2, RGSRIEG1Brx1, RIEG, RIEG bicoid-related homeobox transcription factor, rieg bicoid-related homeobox transcription factor 1, RS, solurshin
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PITX2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKR
Quantity: 100 μL
Research Discipline: Stem Cell Markers
Gene ID (Entrez): 5308
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: all1-responsive gene 1, ALL1-responsive protein ARP1, ARP1MGC20144, Homeobox protein PITX2, IDG2, IGDS, IGDS2, IHG2, IRID2, Otlx2, paired-like homeodomain 2, Paired-like homeodomain transcription factor 2MGC111022, pituitary homeo box 2, pituitary homeobo
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 5308
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: biogenesis of lysosome-related organelles complex 1 subunit 3, biogenesis of lysosomal organelles complex-1, subunit 3, BLOS3, HPS8, RP
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 388552
Target Species: __
Isotype: __