BARD1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255593-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255593 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
BARD1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
BARD-1, BRCA1 associated RING domain 1, BRCA1-associated RING domain gene 1, BRCA1-associated RING domain protein 1, EC 6.3.2.-
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
BARD1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEI
Quantity
100 μL
Research Discipline
Breast Cancer, Cancer
Gene ID (Entrez)
580
Target Species
Human
Isotype
IgG
Related Products
Description
- BARD1 Polyclonal specifically detects BARD1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: BARD1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: BARD-1, BRCA1 associated RING domain 1, BRCA1-associated RING domain gene 1, BRCA1-associated RING domain protein 1, EC 6.3.2.-
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: BARD1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEI
Quantity: 100 μL
Research Discipline: Breast Cancer, Cancer
Gene ID (Entrez): 580
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: BARD-1, BRCA1 associated RING domain 1, BRCA1-associated RING domain gene 1, BRCA1-associated RING domain protein 1, EC 6.3.2.-
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 580
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: EC 2.7.10, EC 2.7.10.1, EK6, ELK, EPH receptor B1, eph tyrosine kinase 2, EphB1, EPH-like kinase 6, ephrin type-B receptor 1, EPHT2FLJ37986, hEK6, NETHek6, soluble EPHB1 variant 1, Tyrosine-protein kinase receptor EPH-2
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 2047
Target Species: __
Isotype: __