ZGPAT Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255609-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP255609 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
ZGPAT
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
GPATC6G patch domain-containing protein 6, GPATCH6Zinc finger and G patch domain-containing protein, KIAA1847Zinc finger CCCH domain-containing protein 9, MGC44880, ZC3H9FLJ14972, ZC3HDC9dJ583P15.3, zinc finger, CCCH-type with G patch domain, ZIPzinc finger CCCH-type with G patch domain-containing protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
84619
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ZGPAT
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRVEPIHAVVLPRGKSLDQCVETLQKQTRVG
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ZGPAT Polyclonal specifically detects ZGPAT in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ZGPAT
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: GPATC6G patch domain-containing protein 6, GPATCH6Zinc finger and G patch domain-containing protein, KIAA1847Zinc finger CCCH domain-containing protein 9, MGC44880, ZC3H9FLJ14972, ZC3HDC9dJ583P15.3, zinc finger, CCCH-type with G patch domain, ZIPzinc finger CCCH-type with G patch domain-containing protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 84619
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ZGPAT
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRVEPIHAVVLPRGKSLDQCVETLQKQTRVG
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: GPATC6G patch domain-containing protein 6, GPATCH6Zinc finger and G patch domain-containing protein, KIAA1847Zinc finger CCCH domain-containing protein 9, MGC44880, ZC3H9FLJ14972, ZC3HDC9dJ583P15.3, zinc finger, CCCH-type with G patch domain, ZIPzinc fing
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 84619
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Antigen: CCAR1
Classification: Polyclonal
Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: CARP-1, CARP1MGC44628, Cell cycle and apoptosis regulatory protein 1, cell division cycle and apoptosis regulator 1, cell division cycle and apoptosis regulator protein 1, Death inducer with SAP domain, DIS, FLJ10590, RP11-437A18.1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 55749
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CCAR1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KEERDDETEEDNNQDEYDPMEAEEAEDEEDDRDEEEMTKRDDKRDINRYCKERPSKDKEKEKTQMITINRDLLMAFVYFDQSHCGYLLE
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.