CASC3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255636-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255636 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
CASC3
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
barentsz, Btz, cancer susceptibility candidate 3, Cancer susceptibility candidate gene 3 protein, metastatic lymph node 51, Metastatic lymph node gene 51 protein, MLN 51, MLN51BTZ, Protein barentsz, protein CASC3
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
CASC3
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DSEGEEGEYSEEENSKVELKSEANDAVNSSTKEEKGEEKPDTKSTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLR
Quantity
100 μL
Research Discipline
Cancer
Gene ID (Entrez)
22794
Target Species
Human
Isotype
IgG
Related Products
Description
- CASC3 Polyclonal specifically detects CASC3 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: CASC3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: barentsz, Btz, cancer susceptibility candidate 3, Cancer susceptibility candidate gene 3 protein, metastatic lymph node 51, Metastatic lymph node gene 51 protein, MLN 51, MLN51BTZ, Protein barentsz, protein CASC3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CASC3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DSEGEEGEYSEEENSKVELKSEANDAVNSSTKEEKGEEKPDTKSTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLR
Quantity: 100 μL
Research Discipline: Cancer
Gene ID (Entrez): 22794
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: barentsz, Btz, cancer susceptibility candidate 3, Cancer susceptibility candidate gene 3 protein, metastatic lymph node 51, Metastatic lymph node gene 51 protein, MLN 51, MLN51BTZ, Protein barentsz, protein CASC3
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 22794
Target Species: __
Isotype: __
Antigen: RAB42
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: MGC45806, putative Ras-related protein Rab-42, RAB42, member RAS homolog family, RAB42, member RAS oncogene family, RP4-669K10.6
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: RAB42
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GVRLIHKTQIPRSPSRKQHSGPCQC
Quantity: 100 μL
Research Discipline: Signal Transduction
Gene ID (Entrez): 115273
Target Species: Human
Isotype: IgG