DFF40/CAD Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255648-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP255648 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
DFF40/CAD
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CADCaspase-activated nuclease, Caspase-activated deoxyribonuclease, Caspase-activated DNase, CPANDNA fragmentation factor 40 kDa subunit, DFF-40DFF40DFF2DNA fragmentation factor subunit beta, DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase), EC 3.-
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
DFFB
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN
Quantity
100 μL
Research Discipline
Apoptosis
Gene ID (Entrez)
1677
Target Species
Human
Isotype
IgG
Related Products
Description
- DFF40/CAD Polyclonal specifically detects DFF40/CAD in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: DFF40/CAD
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CADCaspase-activated nuclease, Caspase-activated deoxyribonuclease, Caspase-activated DNase, CPANDNA fragmentation factor 40 kDa subunit, DFF-40DFF40DFF2DNA fragmentation factor subunit beta, DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase), EC 3.-
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: DFFB
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN
Quantity: 100 μL
Research Discipline: Apoptosis
Gene ID (Entrez): 1677
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: CADCaspase-activated nuclease, Caspase-activated deoxyribonuclease, Caspase-activated DNase, CPANDNA fragmentation factor 40 kDa subunit, DFF-40DFF40DFF2DNA fragmentation factor subunit beta, DNA fragmentation factor, 40kDa, beta polypeptide (caspase-acti
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 1677
Target Species: __
Isotype: __
Antigen: C9orf25
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: bA573M23.5, C9orf25, chromosome 9 open reading frame 25, family with sequence similarity 219, member A, hypothetical protein LOC203259
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: FAM219A
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSPVNQQPKKNNVMARTRLVVPNKGYSSLDQSPDEKPLVALDTDSDDDFDMSRYSSSGYSSAE
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 203259
Target Species: Human
Isotype: IgG