TSPEAR Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255659-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255659 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
TSPEAR
Classification
Polyclonal
Dilution
Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias
C21orf29, Chromosome 21 Open Reading Frame 29, Deafness, Autosomal Recessive 98, DFNB98, Thrombospondin Type Laminin G Domain And EAR Repeats, Thrombospondin-Type Laminin G Domain And EAR Repeat-Containing Protein, Thrombospondin-Type Laminin G Domain And EAR Repeats-Containing Protein, TSP-EAR
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
54084
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
TSPEAR
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGQEFSVIYKWSHRKLKFTPYQSIATHSARDWEAFEVDGEHFLAVANHREGDNHNIDSVIYKWNPATRLFEANQTIATSGAYDWEFFSVGPYSFLVVANTFNGTST
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- TSPEAR Polyclonal specifically detects TSPEAR in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: TSPEAR
Classification: Polyclonal
Dilution: Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: C21orf29, Chromosome 21 Open Reading Frame 29, Deafness, Autosomal Recessive 98, DFNB98, Thrombospondin Type Laminin G Domain And EAR Repeats, Thrombospondin-Type Laminin G Domain And EAR Repeat-Containing Protein, Thrombospondin-Type Laminin G Domain And EAR Repeats-Containing Protein, TSP-EAR
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 54084
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TSPEAR
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGQEFSVIYKWSHRKLKFTPYQSIATHSARDWEAFEVDGEHFLAVANHREGDNHNIDSVIYKWNPATRLFEANQTIATSGAYDWEFFSVGPYSFLVVANTFNGTST
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: C21orf29, Chromosome 21 Open Reading Frame 29, Deafness, Autosomal Recessive 98, DFNB98, Thrombospondin Type Laminin G Domain And EAR Repeats, Thrombospondin-Type Laminin G Domain And EAR Repeat-Containing Protein, Thrombospondin-Type Laminin G Domain And
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 54084
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Antigen: NARF
Classification: Polyclonal
Dilution: Western Blot 0.04 - 0.4 ug/mL, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Knockdown Validated
Gene Alias: FLJ10067, IOP2DKFZp434G0420, Iron-only hydrogenase-like protein 2, nuclear prelamin A recognition factor, prenyl-dependent prelamin A binding protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 26502
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NARF
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KTDDQENVSADAPSPAQENGEKGEFHKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFRVLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNLSVTDASRRLCGFLKSLG
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.