CNBP Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255690-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP255690 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
CNBP
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CCHC-type zinc finger, nucleic acid binding protein, cellular nucleic acid binding protein, cellular nucleic acid-binding protein, DM2, erythroid differentiation-related, FLJ11631, PROMM, RNF163CNBP1ZNF9ZCCHC22, sterol regulatory element-binding protein, zinc finger protein 273, Zinc finger protein 9, zinc finger protein 9 (a cellular retroviral nucleic acid binding protein)
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
CNBP
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG
Quantity
100 μL
Research Discipline
DNA replication Transcription Translation and Splicing
Gene ID (Entrez)
7555
Target Species
Human
Isotype
IgG
Related Products
Description
- CNBP Polyclonal specifically detects CNBP in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: CNBP
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CCHC-type zinc finger, nucleic acid binding protein, cellular nucleic acid binding protein, cellular nucleic acid-binding protein, DM2, erythroid differentiation-related, FLJ11631, PROMM, RNF163CNBP1ZNF9ZCCHC22, sterol regulatory element-binding protein, zinc finger protein 273, Zinc finger protein 9, zinc finger protein 9 (a cellular retroviral nucleic acid binding protein)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CNBP
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG
Quantity: 100 μL
Research Discipline: DNA replication Transcription Translation and Splicing
Gene ID (Entrez): 7555
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: CCHC-type zinc finger, nucleic acid binding protein, cellular nucleic acid binding protein, cellular nucleic acid-binding protein, DM2, erythroid differentiation-related, FLJ11631, PROMM, RNF163CNBP1ZNF9ZCCHC22, sterol regulatory element-binding protein,
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 7555
Target Species: __
Isotype: __
Antigen: FOXO3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: AF6q21, AF6q21 protein, DKFZp781A0677, FKHRL1MGC31925, FKHRL1P2, forkhead box O3, forkhead box protein O3, forkhead homolog (rhabdomyosarcoma) like 1, Forkhead in rhabdomyosarcoma-like 1, forkhead, Drosophila, homolog of, in rhabdomyosarcoma-like 1, FOXO2, FOXO3Aforkhead box O3A, MGC12739
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: FOXO3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSVVNQNLLHHQHQTQGALGGSRALS
Quantity: 100 μL
Research Discipline: Apoptosis, Cancer, DNA Repair, Transcription Factors and Regulators
Gene ID (Entrez): 2309
Target Species: Human
Isotype: IgG