GTF3C5 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255707-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255707 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
GTF3C5
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
FLJ20857, general transcription factor 3C polypeptide 5, general transcription factor IIIC, polypeptide 5 (63kD), general transcription factor IIIC, polypeptide 5, 63kDa, TF3C-epsilon, TFiiiC2-63, TFIIIC63TFIIIC 63 kDa subunit, TFIIICepsilon, Transcription factor IIIC 63 kDa subunit, Transcription factor IIIC subunit epsilon, transcription factor IIIC, 63 kD
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
9328
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
GTF3C5
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KTSSQLVTMHDLKQGLGPSGTSGARKPASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIIHR
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description GTF3C5 Polyclonal specifically detects GTF3C5 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: GTF3C5
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: FLJ20857, general transcription factor 3C polypeptide 5, general transcription factor IIIC, polypeptide 5 (63kD), general transcription factor IIIC, polypeptide 5, 63kDa, TF3C-epsilon, TFiiiC2-63, TFIIIC63TFIIIC 63 kDa subunit, TFIIICepsilon, Transcription factor IIIC 63 kDa subunit, Transcription factor IIIC subunit epsilon, transcription factor IIIC, 63 kD
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 9328
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: GTF3C5
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KTSSQLVTMHDLKQGLGPSGTSGARKPASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIIHR
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: FLJ20857, general transcription factor 3C polypeptide 5, general transcription factor IIIC, polypeptide 5 (63kD), general transcription factor IIIC, polypeptide 5, 63kDa, TF3C-epsilon, TFiiiC2-63, TFIIIC63TFIIIC 63 kDa subunit, TFIIICepsilon, Transcriptio
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 9328
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Antigen: SLC25A34
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DKFZp781A10161, RP11-169K16.2, solute carrier family 25 member 34, solute carrier family 25, member 34
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 284723
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SLC25A34
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PFDVVSTRLYNQPVDTAGRGQLYGGLTDCMVKIWRQEGPLALYKGLG
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.