AKT2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255812-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255812 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
AKT2
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
EC 2.7.11, EC 2.7.11.1, Murine thymoma viral (v-akt) homolog-2, PKB beta, PKBB, PKBBETA, PRKBB, Protein kinase Akt-2, Protein kinase B beta, rac protein kinase beta, RAC-BETA, RAC-beta serine/threonine-protein kinase, RAC-PK-beta, v-akt murine thymoma viral oncogene homolog 2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
AKT2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMND
Quantity
100 μL
Research Discipline
Apoptosis, Autophagy, Cancer, Growth and Development, Hypoxia, mTOR Pathway, Neuronal Cell Markers, Protein Kinase, Signal Transduction
Gene ID (Entrez)
208
Target Species
Human
Isotype
IgG
Related Products
Description
- AKT2 Polyclonal specifically detects AKT2 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: AKT2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: EC 2.7.11, EC 2.7.11.1, Murine thymoma viral (v-akt) homolog-2, PKB beta, PKBB, PKBBETA, PRKBB, Protein kinase Akt-2, Protein kinase B beta, rac protein kinase beta, RAC-BETA, RAC-beta serine/threonine-protein kinase, RAC-PK-beta, v-akt murine thymoma viral oncogene homolog 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: AKT2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMND
Quantity: 100 μL
Research Discipline: Apoptosis, Autophagy, Cancer, Growth and Development, Hypoxia, mTOR Pathway, Neuronal Cell Markers, Protein Kinase, Signal Transduction
Gene ID (Entrez): 208
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: EC 2.7.11, EC 2.7.11.1, Murine thymoma viral (v-akt) homolog-2, PKB beta, PKBB, PKBBETA, PRKBB, Protein kinase Akt-2, Protein kinase B beta, rac protein kinase beta, RAC-BETA, RAC-beta serine/threonine-protein kinase, RAC-PK-beta, v-akt murine thymoma vir
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 208
Target Species: __
Isotype: __
Antigen: Aspartate Aminotransferase
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Gene Alias: aspartate aminotransferase, cytoplasmic, EC 2.6.1.1, GIG18, Glutamate oxaloacetate transaminase 1, glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1), growth-inhibiting protein 18, Transaminase A
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: GOT1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLH
Quantity: 100 μL
Research Discipline: Lipid and Metabolism
Gene ID (Entrez): 2805
Target Species: Human
Isotype: IgG