TGIF1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255829-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP255829 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
TGIF1
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
5'-TG-3' interacting factor, homeobox protein TGIF, homeobox protein TGIF1, HPE4, MGC39747, TALE homeobox TG-interacting factor, TGFB-induced factor (TALE family homeobox), TGFB-induced factor homeobox 1, TGIFMGC5066,5'-TG-3'-interacting factor 1, transforming growth factor-beta-induced factor
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
TGIF1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQ
Quantity
100 μL
Research Discipline
Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez)
7050
Target Species
Human
Isotype
IgG
Related Products
Description
- TGIF1 Polyclonal specifically detects TGIF1 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: TGIF1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 5'-TG-3' interacting factor, homeobox protein TGIF, homeobox protein TGIF1, HPE4, MGC39747, TALE homeobox TG-interacting factor, TGFB-induced factor (TALE family homeobox), TGFB-induced factor homeobox 1, TGIFMGC5066,5'-TG-3'-interacting factor 1, transforming growth factor-beta-induced factor
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TGIF1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQ
Quantity: 100 μL
Research Discipline: Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez): 7050
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: 5'-TG-3' interacting factor, homeobox protein TGIF, homeobox protein TGIF1, HPE4, MGC39747, TALE homeobox TG-interacting factor, TGFB-induced factor (TALE family homeobox), TGFB-induced factor homeobox 1, TGIFMGC5066,5'-TG-3'-interacting factor 1, transfo
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 7050
Target Species: __
Isotype: __
Antigen: ALS2CR3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: ALS2CR3GRIF1, CALS-C, GRIF-1, KIAA0549amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 3, OIP98Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 3 protein, trafficking kinesin-binding protein 2, trafficking protein, kinesin binding 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TRAK2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEEEGITFQVQQPLEVEEKLSTSKPVTGIFLPPITSAGGPVTVATANPGKCLSCTNST
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 66008
Target Species: Human
Isotype: IgG