Ku80/XRCC5 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255954-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255954 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Ku80/XRCC5
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
80kDa, ATP-dependent DNA helicase 2 subunit 2, ATP-dependent DNA helicase II 80 kDa subunit, CTC85, CTCBF, EC 3.6.4.-, FLJ39089, G22P2, KARP1, KARP-1, KU80, Ku86 autoantigen related protein 1,86 kDa subunit of Ku antigen, Ku86DNA repair protein XRCC5, KUB2, NFIV, Thyroid-lupus autoantigen, TLAA, X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining)CTC box-binding factor 85 kDa subunit, X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining; Ku autoantigen, 80kD), X-ray repair cross-complementing protein 5, X-ray repair, complementing defective, repair in Chinese hamster
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
XRCC5
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQD
Quantity
100 μL
Research Discipline
Cancer, Chromatin Research, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, Non homologous end joining, Stem Cell Markers
Gene ID (Entrez)
7520
Target Species
Human
Isotype
IgG
Related Products
Description
- Description Ku80/XRCC5 Polyclonal specifically detects Ku80/XRCC5 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Ku80/XRCC5
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 80kDa, ATP-dependent DNA helicase 2 subunit 2, ATP-dependent DNA helicase II 80 kDa subunit, CTC85, CTCBF, EC 3.6.4.-, FLJ39089, G22P2, KARP1, KARP-1, KU80, Ku86 autoantigen related protein 1,86 kDa subunit of Ku antigen, Ku86DNA repair protein XRCC5, KUB2, NFIV, Thyroid-lupus autoantigen, TLAA, X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining)CTC box-binding factor 85 kDa subunit, X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining; Ku autoantigen, 80kD), X-ray repair cross-complementing protein 5, X-ray repair, complementing defective, repair in Chinese hamster
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: XRCC5
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQD
Quantity: 100 μL
Research Discipline: Cancer, Chromatin Research, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, Non homologous end joining, Stem Cell Markers
Gene ID (Entrez): 7520
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: 80kDa, ATP-dependent DNA helicase 2 subunit 2, ATP-dependent DNA helicase II 80 kDa subunit, CTC85, CTCBF, EC 3.6.4.-, FLJ39089, G22P2, KARP1, KARP-1, KU80, Ku86 autoantigen related protein 1,86 kDa subunit of Ku antigen, Ku86DNA repair protein XRCC5, KUB
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 7520
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: Alpha-synuclein-interacting protein, MGC39814, Sph1, synphilin-1, synuclein, alpha interacting protein, SYPH1
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 9627
Target Species: __
Isotype: __
